KEGG   Rattus norvegicus (rat): 363513
Entry
363513            CDS       T01003                                 

Gene name
Ids
Definition
(RefSeq) iduronate 2-sulfatase isoform X1
  KO
K01136  iduronate 2-sulfatase [EC:3.1.6.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    363513 (Ids)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    363513 (Ids)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.13  iduronate-2-sulfatase
     363513 (Ids)
SSDB
Motif
Pfam: Sulfatase Phosphodiest DUF229
Other DBs
NCBI-GeneID: 363513
NCBI-ProteinID: XP_038956467
RGD: 1560491
Position
X
AA seq 554 aa
MSPPPPPPPTTWRQLSFSLLLGFFCIALVSAAQGNSATDALNILLIIVDDLRPSLGCYGD
KLVRSPNIDQLASHSIVFENAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHSGNF
STIPQYFKENGYVTMSVGKVFHPGISSNHSDDYPYSWSFPPYHPSSEKYENTKTCKGQDG
KLHTNLLCPVDVADVPEGTLPDKQSTEEAIRLLEKMKTSVSPFFLAVGYHKPHIPFRYPK
EFQKLYPLENMTLAPDPHVPDSLPPVAYNPWMDIREREDVQALNISVPYGPIPVDFQRKI
RQSYFASVSYLDTQVGHLLSALDDLRLAHNTIIAFMSDHGWALGEHGEWAKYSNFDVTTR
VPLMFYVPGKTALLPAAGEKLFPYQDPFDPASELMGAGRRTEDLVELVSLFPTLAGLAGM
PVPPWCPIPSFHVELCREGHNLQRYLQLHDLEEDPYLFGNPRELIAYSQYPRPADFPQWN
SDKPSLKDIKVMGYSIRTIDYRYTVWVGFSPTEFLANFSDIHAGELYFVDSDPLQDHNVY
NDSQHGGLLLSLRP
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgtcgccgccgccgccgccgccaccaactacctggcgccagcttagcttcagcttgttg
ctaggcttcttctgtatcgccctggtgtccgcagcgcaaggcaactctgctacagatgct
ctgaatatccttctgatcatcgtggatgatctccgcccctccctgggctgttatggagat
aagctagtgaggtccccaaacattgaccaactggcatcccatagcattgtctttgagaat
gcctttgctcagcaagcagtgtgtgcaccaagtcgagtttccttcctcaccgggaggagg
cctgacaccacccgcctgtatgacttcaattcctactggagggtacactctggaaatttt
tccaccatcccccaatacttcaaggagaatggctacgtgaccatgtcggttgggaaagtc
tttcaccctggtatatcttccaatcacagtgatgattatccatatagttggtcttttcca
ccttatcatccatcctccgagaagtatgaaaacactaagacatgtaagggacaagatgga
aaactccacaccaacctgctttgtcctgtggatgtggcagatgtgcctgagggtaccttg
cctgacaaacagagcacagaggaagccattcgattgttggaaaagatgaaaacgtcagtc
agtcctttcttcctggcggtcgggtatcacaagccacacatccccttcagataccctaag
gaatttcagaagttgtatcccctggaaaacatgaccctggctcctgatccccatgttcct
gatagcctaccacctgtagcctacaacccgtggatggacatcagggagcgggaagatgtc
caagccttaaacatcagtgttccctatggaccaattcctgtggattttcagcggaaaatc
cgccagagctactttgcttctgtgtcctatttggatacacaggtcgggcatcttttgagt
gctttggatgatctccgtctggcccacaacacaattattgctttcatgtctgatcatgga
tgggccctaggtgaacacggagaatgggccaaatacagcaactttgatgtcactacccgt
gtaccactgatgttttatgttcctggaaagacagccctccttcctgcagcaggagagaag
ctctttccttaccaggacccttttgatcccgcttcagaattgatgggtgcaggcaggcgc
actgaggacctcgtagaacttgtgtctctcttccccacgctcgctggacttgcaggaatg
ccagttcctccttggtgccccatcccttcttttcatgttgagctgtgcagagaaggccat
aatctccagaggtatttgcagctccatgacttggaagaggatccatacttgtttggtaat
ccccgggagttgattgcctacagccagtatccccggcctgcagatttccctcagtggaat
tctgacaagccaagcttaaaagatataaaggtcatgggatactccatacgcaccatagac
tataggtatactgtgtgggttggcttcagtcctactgagtttctggctaacttttctgat
atccatgctggggaactctattttgtcgattctgacccactgcaggatcacaatgtatat
aatgactcccaacatggaggtcttctcctctcactgagaccttga

DBGET integrated database retrieval system