KEGG   Rattus norvegicus (rat): 363517Help
Entry
363517            CDS       T01003                                 

Gene name
Plxnb3, RGD1560615
Definition
(RefSeq) plexin B3
  KO
K06821  plexin B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    363517 (Plxnb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Motif
Other DBs
NCBI-GeneID: 363517
NCBI-ProteinID: NP_001129350
RGD: 1560615
Ensembl: ENSRNOG00000061731
UniProt: D3ZLH5
Position
Xq37
AA seq 1902 aa AA seqDB search
MLTDFLQAPVMAPWSPFSLHLLLLFLLLLPLTRAHRFSVPNASFNHLVLAPDQGKLYVGA
VNHLFQLSPELEMESVAITGPVIDSPDCVPFRDLAECPQAQLTDNANQLLLVSSRAQELV
ACGQVRQGVCEKRRLGDVTQVLYQAEDPGDGQFVAANTLGVTTVGLVVPLPGRDLLLVAR
GLAGKLSAGVPPLTVRQLAGPQPFSSEGLGRLVVGDFSDYNNSYVGAFSDAHSAYFVFRR
RGARAQTEYRSYVARVCLGDVNLYSYVEVPLTCHGQGLIQAAFLAPDTLLGAFSAGTSQA
QAALCAFPLADLDGSMEQARRLCYTTGGQGPNGMEEATVEYGVTSRCVTLPPDSPESYPC
GDEHTPSPIAGRQPLEAQPLLQLGQPISAVAALQTDGHTIAFLGDTEGQLHKVFLNSSHG
QVYHSQQVGPPGSAISPDLLVDNSGDYLYVLTAQQVDRILVAACPQFPNCTTCLQARDPL
CGWCILQGRCTRRAECGRAVQPNQWLWSYEDNHCLHIQSLLPAQHPRQEHGQITLSVPGL
PNLAMDEYFYCAFGDYNSLAQVEEHHVVCATPPQDRMPPNPPGSDHVTLPLALMFEDVVL
AATTFSFYDCSAIQALEVAAPCRTCVSSLWRCHWCPQSSHCVYGERCPEGEKAVYSAQEV
DILVRGPEACPQVKGLASPQLVPVGWESHVTLHIENLHYFRGLPALYYCWLELPGKLRKL
PAFLEETSRNSGLIHCQAQQFHPSMSQWELPVPIYVTRGEIQRLDNTGDLHVTLYDCAMG
HPDCSHCQAANGSLSCLWCGDGQPACRYGPLCPPGAVEQLCPIPSIDVIEPLTGPPEGGL
AITILGSNLGQAFNDVRNAVTVAGQPCNPDPSLYRISARIVCVTSPAPNGTSGPVQVAIK
SRPPGISAQHFTYQDPVLLSLNPQWGPQAGGTQLTIHGQYLQTGGNVSAFVGDQPCPIQE
PVCPEAIICHTMPQMEPGEAVVFVVFGHVERKLLTTPFRYTANPQLVEAEPSVSFRGGGR
VIRVRGTGLDVVWQPLLSVWLEDEFQVKALGVQAQDVNPRRSCGAPAADPQACIHLESGL
LQCSTLCSVNSSSLLLCHSPAVPDGALPKRVFFALDNMQVDFASASGGQGFLYQPNPRLA
PLSHEGITHPYRLKPGHVLDVEGEGLNLGISKEEVQVHIGDGKCLVKTLTLTHLYCEPPQ
QAPQPTNGSGTLPQFVVQMGNVRLALGPVQYEAEPMISTFPVEAQVGLGMGAAMLIAAVL
LLTLMYRHKSKQALRDYQKVLVQLENLETGVGDQCRKEFTDLMTEMTDLTSDLEASGIPF
LDYRTYAERAFFPGHVGCPLQPGLEGPGEEGRRVTVCQGLTQLSNLLNSKLFLLTLIHTL
EEQPSFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLAAHYVHKNPKLMLRRTETMV
EKLLTNWLSICLYAFLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLNDSHLLRED
VEFRPLTLMALVGPGAGGAAGNSEVHRVPARVLDTDTITQVKEKVLDQIYKGTPFSQRPS
VHSLDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVVLIPQLHNGGTV
SQSLEQTGCHSGENTPMLEDGEEGGVRLWHLVKATEETEGAKVRRSSLRERERERARAKA
IPEIYLTRLLSMKGTLQKFVDDTFQAILSMNRPVPIAVKYLFDFLDELAEKHGIEDPETL
HIWKTNSLLLRFWVNALKNPQLIFDVRVSDNEDAILAVIAQTFIDSCMVSEHKVGRDSPV
NKLLYAREIPRYKQMVEKYYADIRQSSPASYQEMNSALAELSGNYTSAPNCLEALRELYN
HIHRYYDQIISALEEDPVAQKMQLACRLQQVAALVEYKVTDL
NT seq 5709 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgacttcctccaggctcctgtgatggctccctggtctcccttcagcctccac
cttctgctgctgttcctgctgttgctgcccttgaccagggcccatcgcttctctgttccg
aacgccagcttcaaccacctggtgctggcaccagaccagggcaaactctatgtgggtgca
gtgaatcacctcttccagctcagccctgagctggagatggagtctgtggctatcactggc
cctgtcattgacagtcctgattgtgtgcctttccgtgacctggctgagtgcccacaggcc
cagctcactgacaatgccaaccagctcttgctggtaagcagcagggcacaggagctggtg
gcttgtggacaagtgaggcagggtgtatgtgagaagcggcgccttggggatgttactcaa
gtgctgtaccaggcggaggaccctggtgatgggcagtttgtggctgccaataccctggga
gtgaccacagtaggcctagtggtgcctttgccaggccgagacctcctgctggtggccaga
ggcctggcaggcaagctgtcagcaggagtgccacccctaactgtgcgccagctggctggg
ccacagcctttctccagcgaaggtctgggaagacttgtggtgggtgacttttcagactat
aacaatagctatgtaggggctttttctgatgctcattctgcctactttgtcttccgtcgc
cgtggggctcgggcccagactgagtatcgctcctatgtagctcgcgtctgcctcggagat
gtcaacctttattcctatgtggaagtgccccttacctgccatggccagggtcttatccag
gctgccttccttgctccggacaccttgctgggcgcattttcagcaggcacaagtcaggca
caggcagccctgtgtgcctttcccttagctgacctggacgggagtatggaacaagccagg
cgactttgctatactactggtggtcagggtcccaacggcatggaagaagccactgtggag
tatggtgtcacatcccgttgtgtcactctgcctcctgactcccccgagtcatacccctgt
ggtgatgaacacacccccagccccatcgcaggccgccaacccctggaggcccagcctctg
ctgcagctgggacagcccatcagtgcagtggctgctctccagacagatgggcacacgata
gccttcctgggagacaccgagggtcaactacataaggtctttctaaacagctcccatggc
caggtataccattcccagcaagtggggcccccaggctcagccatcagcccagacctgctg
gtagacaacagtggagactacctctatgtcctgactgcccagcaggtagacaggatactt
gtggcagcctgccctcagtttcctaactgcactacctgcctccaggccagggacccactg
tgtggctggtgcatacttcagggcaggtgcactcggagggccgagtgtgggagagcagtt
cagccaaaccagtggctatggagctatgaagacaaccactgccttcacatccagagcctg
ctaccagcccagcacccccgtcaggaacatggccagatcactctgtctgttcctgggctg
cccaacctggccatggatgaatacttctactgtgcctttggggactacaacagtctagct
caggtggaagagcaccatgtggtctgtgccacccctcctcaagatcggatgccacctaat
cctccaggctcagatcatgtcaccttgcccctggccctgatgtttgaggatgtggtattg
gctgccaccacattctccttctatgactgcagcgctattcaggccttggaagtggctgcc
ccgtgccgcacttgtgtgagcagcctgtggcggtgccactggtgcccccagagtagccac
tgtgtatatggagagcgctgcccagagggtgaaaaggctgtctacagtgcccaggaggtg
gacatcctggttcgtggcccagaggcttgcccccaggttaagggtctagcaagtccccag
ttggtgcctgtgggctgggagagccatgtgaccctgcacattgagaaccttcactatttc
cgaggtctgcctgccttgtactattgctggctagaactgcctggaaaactgcgaaagcta
cctgccttcctagaggagacatccaggaactctggcctcattcactgccaggcccagcag
ttccacccctctatgtctcagtgggagctcccagtgcccatctatgtaaccaggggtgag
atccagcggctggacaataccggtgatcttcatgtgactctatatgactgtgccatgggt
caccctgactgcagccactgtcaggcagccaatgggagcctgagctgcttgtggtgtggt
gatggccagcctgcctgccgctacgggccgctgtgcccaccaggtgctgtggaacagcta
tgccctatacccagcattgatgtgattgaacccctgactggtcccccagaaggtggctta
gccatcaccatcctgggatccaacctgggccaggcctttaatgatgtgcgaaatgctgtg
actgtggctggccagccctgcaaccctgacccttctctctaccgcatctctgcccggatt
gtatgtgtcacatctcctgctcccaatggcacttctggaccagtccaagtggccattaag
agtcgtcctcctggcatctcggcccagcacttcacctaccaggaccctgtcctgctgagc
ctgaatcctcagtggggcccccaggcagggggcacccagctcaccattcatgggcagtac
ctccagacaggaggcaacgtcagtgcttttgtgggggaccaaccttgccctattcaagag
cctgtgtgtcctgaagccatcatatgccacaccatgccccagatggagccaggagaagca
gtggtcttcgtagtctttggccatgttgaacgcaaactgctcaccactccttttcgatac
actgccaacccccaactggtggaagcagagcctagtgtcagcttccgaggaggtggacga
gtgattcgagttaggggtacaggcttagatgttgtgtggcagcccttgctgtctgtgtgg
ctggaggatgagttccaagtgaaggctttgggcgtgcaggcccaggatgtgaacccaagg
aggagctgtggtgcccctgctgcagatcctcaggcttgtatccatcttgagagtggctta
ctacagtgctccactctctgctctgtcaactcatctagtctcctcctgtgccacagtcca
gcggtgccagatggggccctcccaaagcgagtcttctttgccctagacaacatgcaagta
gactttgccagtgctagtgggggccagggattcctctaccagcctaaccctcgcctggct
ccacttagtcatgaggggattactcacccctatcggctcaagccaggtcatgtcctggat
gtggagggcgagggcctcaatctggggatcagcaaggaggaggtgcaggtgcatattgga
gatgggaagtgcctggtgaagacgctgacgcttactcacttgtactgtgaaccaccccag
caagcccctcagcccaccaatggttcaggcaccctgccacagtttgtggtgcagatgggc
aatgtgcgcctggctctaggccctgttcagtatgaagcagagcccatgatatccaccttt
cctgtggaggcccaggtgggcctgggcatgggtgctgccatgctgattgctgcagtgcta
ctcctcaccctcatgtacaggcacaagagcaagcaggccttgcgagactatcagaaggta
ctggtgcagttggagaacctggagactggtgtgggtgaccagtgccgcaaggagttcaca
gacctgatgactgagatgacagacctcaccagtgacctagaggccagtgggattcccttc
ctggattaccgaacatatgctgagcgtgctttcttccctggccatgttggctgcccactg
cagccagggctcgaggggcctggggaagagggtcgccgtgtcaccgtgtgccagggtctc
acacaactctccaatttgctcaacagcaagctcttccttctcacactcatccacacctta
gaggagcagccaagcttttcccagagggaccgctgccatgtggcttcactactttctctg
gctctgcacagcaagcttgaatatttgaccgacatcatgagaactctgcttggtgaccta
gcagcccattatgtacacaagaaccccaagctcatgttacgcaggacagagaccatggta
gagaagctgctcaccaactggctatctatctgtctctacgccttcttgaaggaagtggct
ggtgagccactgtacatgctcttccgggccatcaagtaccaggtggacaagggccctgtg
gacgctgtgacaggcaaggcaaaacgaactctgaatgacagccacctactacgagaggat
gtggagttccggcccctgaccctgatggcattggtgggaccaggggctggtggggcagca
ggaaacagtgaagtacatcgagtgccagcccgggtgcttgatacagacaccatcacccaa
gtcaaagagaaggtgttggatcaaatctacaagggaactcccttctcccagaggccttca
gtgcactccctagaccttgagtggcgctcaggcctagctggtcacctaaccttgtcagat
gaggatttgacctctgtgactcaaaaccactggaagagactcaacaccctacaacactac
aaggtcccagatggagcaacagtggtactcattcctcagctgcacaatggtggcactgtc
tcccagagtctggagcagactggctgccattctggagagaacactcccatgctggaagat
ggtgaagaaggtggagttcggctttggcacctggtaaaggccactgaggagacagaaggg
gccaaagtgcggcgcagcagcctccgggaacgagaacgagaacgggcacgagccaaggcc
attcctgaaatctatcttactcgcttactttcaatgaagggcaccctgcagaagtttgtg
gatgacaccttccaggccattcttagcatgaataggcctgtgcctattgctgttaagtac
ctatttgacttcttggatgagctggcagagaaacatggcattgaagatccagagaccctg
cacatttggaagacaaacagcttattgctgcgattctgggtgaatgccttgaagaaccca
cagctcatctttgatgttcgagtgtcagacaacgaggatgccatcttggctgtcatcgca
cagaccttcatcgattcctgcatggtctcagagcataaagtgggccgggattccccagtg
aacaaactgctctatgcccgggagatccctcgctacaagcagatggtggagaagtactat
gcggacattcgccagagctctccagcgagctatcaagagatgaactcagctctggctgaa
ctctctgggaattatacttctgctcccaactgtctggaggctcttcgagaactttacaac
cacatccacaggtattatgaccagatcatcagtgccctggaggaggaccccgtggcccag
aagatgcagctggcttgccgcctgcagcaggtcgctgccttggtggagtacaaagtgact
gatttatga

DBGET integrated database retrieval system