KEGG   Rattus norvegicus (rat): 363520Help
Entry
363520            CDS       T01003                                 

Gene name
Irak1, RGD1563841
Definition
(RefSeq) interleukin-1 receptor-associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    363520 (Irak1)
   04064 NF-kappa B signaling pathway
    363520 (Irak1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363520 (Irak1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    363520 (Irak1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    363520 (Irak1)
   05133 Pertussis
    363520 (Irak1)
   05152 Tuberculosis
    363520 (Irak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    363520 (Irak1)
   05162 Measles
    363520 (Irak1)
   05161 Hepatitis B
    363520 (Irak1)
   05168 Herpes simplex virus 1 infection
    363520 (Irak1)
   05169 Epstein-Barr virus infection
    363520 (Irak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    363520 (Irak1)
   05140 Leishmaniasis
    363520 (Irak1)
   05142 Chagas disease (American trypanosomiasis)
    363520 (Irak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363520 (Irak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     363520 (Irak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  IRAK family
   363520 (Irak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death RAMP APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 363520
NCBI-ProteinID: NP_001121027
RGD: 1563841
Ensembl: ENSRNOG00000060869
UniProt: B2RYH5
Position
Xq37
AA seq 710 aa AA seqDB search
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPASVLPPSTGAPRPSS
ISAGSETEDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLSDSLGPPLQSSAPSSIK
PSPESPVSGLQRARPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTVVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGFYCLVYGFLPNGSLEDQL
HLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFG
LARFSRFAGANPSQSSTVARTCTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAG
QRAVRTQGAKTKYLKDLIEDEAEEVGVTLKSTQPTLWMGVATDAWTAPIAAQIYKKHLDS
RPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAVPPWKLEVAGHGSPSPQ
ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWH
LTPDSHPSPVSFREASCTQGGTTRESSLRSGPGFQPTTMEGSSMGSSSLLSSEPPQIIIN
PARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKRKRPEESDEFQS
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggccgggggcccgggccccggggagcctgtggttcccggcgcccagcatttcttgtac
gaggtgcctccctgggttatgtgccgtttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgcggccttgatcgtgcgcgaccagacagagctgcggctgtgtgag
cgctccgagcagcgcacggccagtgtcctgtggccctggatcaaccgcaacgcgcgtgtg
gctgacctcgttcacatcctcacgcacctgcagctgctgcgtgcgcgggacatcattaca
gcctggcaccctcctgcctctgttctgcccccaagcaccggtgccccaaggcccagcagc
atctctgcaggctctgagactgaggactggagcccccggaaattgcagtcctctgcctcc
accttcctctccccagcttttccaggctcccagacccattctgagtcagagctcctccag
gttccactctctgattccctcgggccaccactacaatcttcagccccctcctccatcaag
ccaagcccagagagcccagtgtctggcctccaaagagctcgtccctccccattttgctgg
cccttctgtgagatttcccaaggcacttgcaacttctctgaagaactcaggattggagag
ggtggttttgggtgtgtgtaccgagcagtaatgagaaatactacatatgctgtgaagaga
ctgaaggaggaggctgacctagagtggactgtggtgaaacagagcttcctaacagaggtg
gaacagctatcaaggtttcgtcacccaaatatcgtggactttgctggctactgtgcagag
agtggcttctactgccttgtttatggcttcctgcccaatggctccttagaggatcagctt
caccttcagacccaagcctgctccccactttcctggcctcaacgactggacattcttctg
ggcacagcccgggctattcagtttttacatcaggacagccccagccttatccatggagac
atcaagagttctaatgtgcttctggatgagagactgatgcccaagctgggagactttggt
ctggctcgtttcagccgctttgcaggggccaacccaagccagagcagtactgtggcccgg
acttgcacagttcgaggtaccctcgcctacctgcctgaggagtacatcaagacaggccgg
ctggctgtggacaccgataccttcagctttggggtggtaatactggagacccttgctggt
cagagggctgtgaggacacaaggtgcaaaaaccaaatatctgaaagacctgattgaagat
gaggctgaagaggtgggagtgaccttaaaaagcacccagcctactttgtggatgggtgta
gccacggatgcttggactgctccaattgctgcccagatctataagaagcacctggactcc
agacctgggccctgcccaccccagttgggcctggccctggctcaactagcttgctgctgc
atgcaccgtcgggccaagaagaggccacccatgacccaggtatacaagagactagaaggg
cttcaggcagtacctccctggaagctagaggttgccggccatggctctccttccccacag
gagaactcctacatgtccaccactggcagtgcccagagtggggatgaaccatggcagcct
ctggtagtgaccacaagagctccagcccaggctgcccagcaactccagagaagtcccaac
cagccagtggagagtgatgagagtgttcctggcctctctgctaccctgcattcctggcac
ttgactccagattcccacccaagccctgtgtccttcagagaggctagctgtacacaagga
ggcactaccagagaatcaagtttgaggagtggcccaggcttccagcctacgaccatggaa
ggctcatcgatgggcagttcatccctgctgtcatcagagccaccacagatcatcatcaac
ccagcccgacagaagatggtacaaaagctggccctgtatgaagagggggtcttggatagc
ctgcaactgctgtcatcaggctttttcccaggcttggatttagaacctgaaaagagaaag
agacctgaagaaagtgatgaattccagagctga

DBGET integrated database retrieval system