KEGG   Rattus norvegicus (rat): 363555Help
Entry
363555            CDS       T01003                                 

Gene name
Wfikkn1, Oc29, RGD1565835
Definition
(RefSeq) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
  KO
K23621  WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    363555 (Wfikkn1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   363555 (Wfikkn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kunitz_BPTI Ig_3 I-set Ig_2 ig WAP V-set Kazal_2
Motif
Other DBs
NCBI-GeneID: 363555
NCBI-ProteinID: NP_001123248
RGD: 1565835
Ensembl: ENSRNOG00000021578
UniProt: P0C5J5
Position
10q12
AA seq 552 aa AA seqDB search
MPAPQPLLPLLFAFVLIHLTSETNLLPEPGSHPGMCPNQLSPHLWVDAQSTCERECTRDQ
DCAASEKCCTNVCGLQSCVAARFPSGGPATPETAASCEDFQCPQQGSNCDIWDGQPVCRC
RDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHVVPCKHILSWPPSSPGPPETTAR
PTPGAAPMPPALYNSPSPQAVHVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQM
YGNVVVTSIGQLVLYNAQLEDAGLYTCTARNAAGLLRADFPLSVLQRATTQDRDPGVLAL
AECQPDTQACVGPPTPHHVLWRFDPQRGSCMTFPALKCDGAARGFETYEACQQACVRGPG
DVCALPPVQGPCQGWEPRWAYSPLLQQCHPFIYSGCEGNSNNFESRESCEDACPVPRTPP
CRACRLKSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALDDVLKDDKMGLKFLGTK
YLEVTLSGMDWACPCPNVTVGDGPLVIMGEVREGVAVLDANSYVRAASEKRVKKIVELLE
KKACELLNRFQD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccccacagccactcctgcctctgctctttgccttcgtgctcatccatctgacc
tcggagaccaacctgctgccagagcctggaagccatcctggcatgtgccccaaccagctc
agcccccacctgtgggtcgacgcccagagcacctgtgagcgtgagtgtaccagggaccag
gactgtgcggcatctgagaagtgctgcaccaatgtgtgtgggctgcagagctgtgtggct
gcccgcttccccagtggcggcccagctacacctgagacagcagcctcctgcgaagacttc
caatgcccacaacagggttccaactgtgacatctgggatgggcagccggtttgtcgctgc
cgtgaccgctgtgaaaaagagcccagcttcacttgcgcttctgatggcctcacctattac
aaccgctgctatatggacgcagaagcctgcctgcgaggtctccacctgcatgtcgtaccc
tgtaaacacattctcagttggccacccagcagccccggaccacctgagaccactgctcgc
ccaacccctggggctgctcccatgccacctgccctatacaacagcccctcaccacaagcc
gtgcatgtggggggaacagccagcctccactgtgacgttagtggccgtccaccacctgcc
gtgacatgggagaagcagagccatcagcgggagaacctgatcatgcgccccgaccaaatg
tacggcaacgtggttgtcaccagcattggacagctagtgctctacaatgctcagctggag
gatgcaggcctgtacacctgcaccgcacggaatgctgctggcctgctgcgggctgacttt
cccctttcggttttgcagcgggcaactactcaggacagggacccaggtgtcctggccctg
gctgagtgccagcccgacacacaagcctgtgttggcccacctaccccccatcatgtcctt
tggcgctttgacccgcaacgaggcagctgcatgacattcccagccctcaaatgcgatggg
gctgcccggggctttgagacctatgaggcatgccaacaggcctgtgtccgtggccctggg
gatgtctgtgcgctgcctccagtccagggcccctgccagggctgggagccacgctgggcc
tacagcccactgctgcagcagtgccacccctttatatacagtggctgtgagggaaacagc
aataactttgagagcagggagagctgtgaggatgcttgccctgtaccacgcacaccaccc
tgccgtgcctgccgtctcaagagcaagctggccctgagcttgtgccgcagtgactttgcc
attgtgggcagactcacagaagtactggaggaacccgaggctgcaggcggcattgctcgt
gtggccttagatgacgtgctaaaggatgacaagatgggcctcaagttcttaggcaccaaa
tacctggaggtgacactaagtggcatggactgggcctgcccatgccccaatgtgacagtt
ggcgatgggccactggtcatcatgggtgaggttcgtgaaggtgtggctgtgttggacgcc
aacagctacgtccgtgctgccagtgagaagcgagtcaagaagattgtagaactgcttgag
aagaaggcttgtgaactgctcaaccgcttccaagactag

DBGET integrated database retrieval system