KEGG   Rattus norvegicus (rat): 363578Help
Entry
363578            CDS       T01003                                 

Gene name
Havcr2, tim3
Definition
(RefSeq) hepatitis A virus cellular receptor 2
  KO
K20414  hepatitis A virus cellular receptor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    363578 (Havcr2)
CD molecules [BR:rno04090]
 Proteins
  363578 (Havcr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig I-set Ig_2 Ig_3 Receptor_2B4 Ig_6
Motif
Other DBs
NCBI-GeneID: 363578
NCBI-ProteinID: NP_001094232
RGD: 1305233
Ensembl: ENSRNOG00000031443
UniProt: P0C0K5
Position
10q21
AA seq 282 aa AA seqDB search
MFSWLPFSCALLLLQPLPARSLENAYTAEVGKNAYLPCSYTVPAPGTLVPICWGKGSCPL
LQCASVVLRTDETNVTYRKSRRYQLKGNFYKGDMSLTIKNVTLADSGTYCCRIQFPGPMN
DEKLELKLSITEPAKVIPAGTAHGDSTTASPRTLTTEGSGSETQTLVTLHDNNGTKISTW
ADEIKDSGETIRTAVHIGVGVSAGLALALILGVLILKWYSSKKKKLQDLSLITLANSPPG
GLVNAGAGRIRSEENIYTIEENIYEMENSNEYYCYVSSQQPS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatggcttcccttcagctgtgccctgctgctgctgcaaccactacctgcaagg
tccttggaaaatgcttacacagctgaggtcgggaagaatgcctatctgccctgcagctac
actgtacctgcccctgggacgctcgtgcctatctgctggggcaagggatcctgtcctttg
ttacagtgtgccagtgtggtgctcagaacggatgaaacgaatgtgacatatcggaaatcc
agaagataccagctaaaggggaatttctacaaaggagacatgtcgctgaccataaagaat
gtgactctagctgactctgggacctactgctgcaggatacaattccctggcccaatgaat
gatgaaaaattagagctgaaattaagcatcactgaaccagccaaagtcatcccagctggg
actgctcatggggattctacaacagcttctcccagaaccctaaccactgagggaagtggc
tcagagacacagaccctggtgaccctccatgataacaatggaacaaaaatttccacatgg
gccgatgaaattaaggactctggagaaactatcagaactgctgtccacattggagtaggc
gtctctgctgggctggccctggcacttattcttggtgttttaatccttaaatggtattcc
tctaagaaaaagaagttgcaggatttgagtcttattacactggccaactccccaccagga
gggttggtgaatgcaggagcaggcaggattcggtctgaggaaaacatctacactatagag
gagaacatatatgaaatggagaattcaaatgagtactactgctatgtcagcagccagcag
ccatcctga

DBGET integrated database retrieval system