KEGG   Rattus norvegicus (rat): 363614
Entry
363614            CDS       T01003                                 

Gene name
Natd1, Gtlf3b
Definition
(RefSeq) N-acetyltransferase domain containing 1
  KO
K06975  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    363614 (Natd1)
SSDB
Motif
Pfam: Acetyltransf_CG Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 DUF3222
Other DBs
NCBI-GeneID: 363614
NCBI-ProteinID: NP_001164012
RGD: 1307740
Ensembl: ENSRNOG00000050567
UniProt: D4A230
Position
10q22
AA seq 110 aa
MAHATPPSALEQGGPIRVEHDRQRRQFSVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDA
YRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcgcacgctaccccgccgagcgcgctggaacagggaggccccatccgcgtggagcac
gaccgccaacgccgccagttctccgtgcgcctcaacggatgtcatgaccgggctgtcctg
ctctatgaatatgtgggcaaacggatcgtggacctgcaacacacagaggtcccagatgct
taccgtgggcgtggcatcgccaagcacctggccaaggccgccctggacttcgtggtggag
gaagacctgaaggcccacctcacctgctggtacatccagaagtatgtcaaggagaacccc
ctgccacagtacctggagcgcctacagccatga

DBGET integrated database retrieval system