KEGG   Rattus norvegicus (rat): 363618
Entry
363618            CDS       T01003                                 

Gene name
Hs3st3a1, Hs3st3a, RGD1561262
Definition
(RefSeq) heparan sulfate-glucosamine 3-sulfotransferase 3A1
  KO
K07809  [heparan sulfate]-glucosamine 3-sulfotransferase 3 [EC:2.8.2.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    363618 (Hs3st3a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    363618 (Hs3st3a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.30  [heparan sulfate]-glucosamine 3-sulfotransferase 3
     363618 (Hs3st3a1)
Glycosyltransferases [BR:rno01003]
 Unclassified
  Sulfotransferases
   363618 (Hs3st3a1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Sulfotransfer_2
Other DBs
NCBI-GeneID: 363618
NCBI-ProteinID: NP_001165538
RGD: 1561262
Ensembl: ENSRNOG00000024591
UniProt: D3ZFR1
Position
10q24
AA seq 393 aa
MAPSGPSGAQLSPAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCPPGSGPVAGVPGRG
VPAGPKELAMWPAGAPRKRLLQLRQRRRRGRPGPGDSSDPDEQSPGLAAAPGGSGAGSSV
AEAQPGTLALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAMGAEPHFFDRSYH
KGLAWYRDLMPRTLEGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDY
TQTLSKRPDIPSFESLTFRNRSAGLIDTSWSAIQIGLYAKHLEPWLRHFPLGQMLFVSGE
RLVSDPAGELRRVQDFLGLKRIITDKHFYFNQTKGFPCLKKAEGSGKPHCLGKTKGRAHP
TIAREVLRQLRDFYRPFNRKFYQMTGRDFGWDG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggccccctcgggtccctctggcgcgcagctcagcccggcggagccactgtcgcgcagt
atcttcaggaagttcttgctgatgctctgctcgctactcacttccctctacgtcttctac
tgcctggccgagcgctgcccgccgggctccggccccgtcgcgggggtcccagggcgcggc
gttcctgctggacccaaggaactggcgatgtggcccgcgggggcgccaaggaagcgcctc
ctgcagctgcggcagcggaggaggcgcgggcggccagggccaggagacagcagcgacccg
gacgagcagagccctgggctggccgccgctccaggcggctccggggcggggagcagcgtg
gcagaggcccaacctgggaccctggccttactcctggacgagggcagcaagcaactgccg
caggccatcatcatcggcgtgaagaagggcggcacgcgggcgctgctggagtttctgcgc
gtgcaccccgacgtgcgcgccatgggcgccgagccccactttttcgaccgcagctaccac
aagggcctcgcctggtaccgggacctgatgcccagaacccttgagggacagatcaccatg
gagaagacgcccagctactttgtgacccgggaagcacccgcacgcatctcagccatgtcc
aaggataccaagctcatcgtggtggtgcgcgacccggtgaccagggccatctcggactac
acgcagacgctgtccaagcggccggacatccccagcttcgagagcctgacgttccgcaac
cgcagcgcgggcctcatagacacgtcctggagcgccatccagatcggtctgtacgccaag
cacctggagccctggctgcgccacttcccgctcggccagatgctcttcgtgagcggggag
cgcctggtcagcgacccggccggggagctgcgccgcgtgcaggatttcctgggcctcaag
cgcatcatcaccgacaagcacttctacttcaaccagaccaagggcttcccgtgcctcaag
aaggcggagggcagcggcaagccgcactgcctgggcaagactaagggccgcgcgcacccc
accatcgcgcgcgaggtgctgcggcagctgcgtgacttttaccggcccttcaaccgcaaa
ttttaccagatgaccggccgcgacttcggctgggatggatag

DBGET integrated database retrieval system