KEGG   Rattus norvegicus (rat): 363644Help
Entry
363644            CDS       T01003                                 

Gene name
Glod4, RGD1307010
Definition
(RefSeq) glyoxalase domain containing 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4
Motif
Other DBs
NCBI-GeneID: 363644
NCBI-ProteinID: NP_001014249
RGD: 1307010
Ensembl: ENSRNOG00000007788
UniProt: Q5I0D1
Position
10q24
AA seq 298 aa AA seqDB search
MVTRRALHFVFKVGNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGPYDGKWSKTMVGF
GPEDDHFVAELTYNYGIGDYKLGNDFMGLTLASSQAVSNARRLEWPLSKVAEGVFETEAP
GGYKFYLQDRSPSQSDPVLKVTLAVSDLQKSLNYWSNLLGMKIYEQDEEKKWALLGYADD
QCKLELQGIQGAVDHSAAFGRIAFSCPQKELPDLEDLMKRESQSILTPLVSLDTPGKATV
QVVILADPDGHEICFVGDEAFRELSKMDPKGSKLLDDAMAADKSDEWFATRNKPKASG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggtcactcgtcgagctctgcatttcgttttcaaagtggggaaccgcttccagacggtg
catttctttcgagatgtcctggggatgcaggttctgcgccatgaggaatttgaggaaggc
tgcaaagccgcatgtaatgggccttatgatgggaaatggagtaaaacaatggtgggattt
gggcctgaggatgaccattttgttgcagaactgacatacaattacggcatcggagactac
aagcttggcaatgacttcatgggactcacgcttgcttccagccaggctgtcagcaatgcc
aggaggctggagtggccactcagtaaagttgcagaaggggtttttgaaactgaggcccca
ggaggatataagttctacttacaggacagaagtccatctcaatcagatcctgtattaaag
gtgactctagcagtgtctgatctccagaagtccttgaactactggtctaatctcttagga
atgaaaatttatgagcaagacgaggaaaagaaatgggctttgctgggctatgctgatgac
cagtgcaagctggagctacagggcatccagggtgcagttgatcattcagcggcctttgga
agaattgccttttcttgtcctcagaaagagttgccagacttagaagacttgatgaaaagg
gagagccaatcgatcctgactccgctggtgagtctggacaccccagggaaagcaacagtg
caagtggttatcctggctgaccctgatggacatgaaatttgctttgttggggacgaagct
ttccgagagctctctaagatggatccaaaaggaagcaaattgttggatgatgcaatggca
gcagacaaaagtgacgagtggtttgctacaagaaataaaccaaaggcttcgggttaa

DBGET integrated database retrieval system