KEGG   Rattus norvegicus (rat): 363675Help
Entry
363675            CDS       T01003                                 

Gene name
Stard3
Definition
(RefSeq) StAR-related lipid transfer domain containing 3
  KO
K22291  StAR-related lipid transfer protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    363675 (Stard3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363675 (Stard3)
Transporters [BR:rno02000]
 Other transporters
  Others
   363675 (Stard3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MENTAL START
Motif
Other DBs
NCBI-GeneID: 363675
NCBI-ProteinID: NP_001014251
RGD: 1549768
Ensembl: ENSRNOG00000042044
UniProt: Q5U2T5
Position
10q31
AA seq 446 aa AA seqDB search
MSKLPGDLAGDLERSLPALASLGTSLSHSQSLSSHFIPPPLEKRRVVSDVRRTFCLFVTF
DLLFISLLWIIELNTNTGIRKNLEQEVIHYSFQSSFFDIFVLAFFRFSGLLLGYAVLRLQ
HWWVIAITTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAE
EERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDSESDEEVAGKKSFSAQEREYI
RQGKEATAVVDQILAQEENWKLERRNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQE
VILQPERMVLWNKTVTACQILQRVEDNTLVSYDVSSGAAGGVVSPRDFVNVRRIERRRDR
YLSSGIATTHCSKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLI
HQSLGATMFEFAFYLRQRVGELGARA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcctggcgatctggccggtgacttggagcgcagtttgccggccctggcc
tccctgggcacctcactgtcccacagccagagcctctcctcacacttcatcccaccacct
ctggagaagcgcagggtcgtctctgacgtccgccgcaccttctgcctcttcgtcaccttc
gacttgctcttcatctccctcctctggatcatcgagctaaataccaacactggcatccgg
aaaaacctggagcaggaggtcatccactacagctttcagagctcattcttcgacatcttt
gttctggctttcttccgcttctctgggctgctcctgggctacgctgtgctacggctccag
cactggtgggtgattgcgatcaccacgctggtgtccagtgcattcctcattgtcaaggtc
atcctttccgagttgctcagcaaaggggcgttcgggtacctgctccccatcgtctctttc
gtcctggcctggctggagacctggttccttgatttcaaagtcctaccccaggaggctgaa
gaggagagatggtatctcgctgcccaggctgctgttgcccgtggaccccttctattctcc
ggtgctttgtctgagggccagttctactctcccccagaatcctttgcagggtctgacagt
gaatcagatgaggaagtcgctgggaagaaaagtttctctgcccaggagcgggagtacatc
cgtcaggggaaggaagccactgcagtggtggatcagatcttggcccaggaggagaactgg
aaattggagaggagaaatgagtatggggacactgtgtacaccattgaagttcccttccat
ggcaagaccttcatcttgaagaccttcctgccctgtcctgctgagctggtataccaggaa
gtgatcctgcagcctgagaggatggtactatggaacaagacggtgaccgcctgccagatc
ctacagcgggtggaggataacacccttgtctcctatgatgtgtcgtccggagccgcaggt
ggcgtcgtgtcccccagggactttgtgaatgtccgacgcattgagcggcgcagagaccgg
tatctgtcatctggtattgccaccacacactgctccaagccccccacgcacaaatacgtc
aggggagagaatggccctggaggcttcattgtgctcaagtcagccagcaacccccgggtc
tgcaccttcgtctggattcttaacacagacctcaagggccgcctgcctcggtacctcatc
caccagagccttggggccaccatgtttgaatttgccttttacctgcggcagcgtgttgga
gagctgggcgcccgagcctga

DBGET integrated database retrieval system