KEGG   Rattus norvegicus (rat): 363707
Entry
363707            CDS       T01003                                 

Gene name
Srp68
Definition
(RefSeq) signal recognition particle 68 kDa protein
  KO
K03107  signal recognition particle subunit SRP68
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    363707 (Srp68)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    363707 (Srp68)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   363707 (Srp68)
SSDB
Motif
Pfam: SRP68 TPR_6 UNC80
Other DBs
NCBI-GeneID: 363707
NCBI-ProteinID: NP_001102310
RGD: 1305376
Ensembl: ENSRNOG00000009351
UniProt: B2RYI2
Position
10
AA seq 625 aa
MAAEKQIPGGGSGGGGSGGGGGGGGSGGGRSAGGDENKENERPSAGSKANKEFGDSLSLE
ILQVIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTDS
RYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESSRVDAK
TKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNRCKTIYEKLASAFTEEQAVLYNQRVEEIS
PNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGR
TVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDALQAVREELKPDQKQ
RDYTVDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLHRALLQQQPEDDSKRSPRP
QDLIRLYDIILQNLVELLQLPGLEEDRTFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWSE
ALVLYDRVLKYASEVSSHGGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDANESHQT
DTASQVKDNTPLVERFETFCLDPSLVTKQASLVHFPPGFQPIPCKPLFFDLALNHVAFPP
LEDKLEQKTKSGLTGYIKGIFGFRS
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggctgctgagaagcagatcccgggtggtggtagtggtggtggtgggagcggcggcggc
ggcggcggcggagggagcggaggtggacgcagtgccggaggagacgagaataaagaaaac
gaacgcccttcagccggatcgaaggcaaacaaagagttcggggatagcctgagtttggag
attctgcaggttattaaggagtcgcagcagcagcatggcctacggcacggagacttccag
cggtacaggggctactgttctcgaagacaaaggcgcctccggaaaacactcaactttaag
atggggaacagacacaaattcaccgggaagaaagtgacagaggagctcctgactgacagc
agatacctgctgctggttctgatggatgcagaaagagcctggagctacgccatgcagctc
aaacaggaagccaacaccgagccccgaaaacggtttcacttgctgtctcgccttcgaaaa
gccgtgaagcacgccgaggaactggagcgcttgtgtgagagcagccgtgtggatgctaag
accaagctagaggctcaggcctatacagcttacctctcggggatgctgcgctttgaacac
caggagtggaaagctgccattgaggctttcaacagatgcaaaactatctatgagaagcta
gccagcgcgttcacagaggagcaggctgtgctgtacaaccagcgcgtagaggagatctcg
cccaacatccgctactgtgcatataacattggggaccagtcagccatcaatgaactcatg
cagatgagactgaggtctgggggcacagaggggctccttgctgaaaaacttgaggccttg
atcactcagactcgagccaagcaggcagcgaccatgagtgaggtggagtggaggggcagg
acggttcccgtgaagatcgacaaagtgaggatcttcttactgggactggctgacaatgaa
gccgccattgtgcaggctgaaagtgaagaaacgaaggagcgtctgttcgagtcgatgctc
agtgagtgccgagacgccctccaggccgtgagggaggagctcaagcctgatcagaaacag
agagattacaccgtcgatggagagtcagggaaggtatcgaatctccagtacctgcacagc
tacctgacctacatcaagctgtccacagcgatcaggagaaatgagaacatggctaaaggg
ctgcacagggctctgctgcagcagcagccggaagatgacagcaagcgctctccccggcct
caggacctcatccggctctacgacatcattctgcagaatctggtggaattgctgcagctt
cctggcttagaagaagacagaaccttccagaaagagataggcctcaagaccctggtgttc
aaagcttacaggtgtttcttcatcgctcagtcctacgtgctggtgaagaagtggagcgaa
gccctcgtcctgtatgacagagttctcaaatatgcaagtgaagtgagttctcatggggga
gccttcaagaacagcctgaaggacctgcctgatgtgcaagagctcatcactcaggtgcgg
tcagagaagtgctcgctgcaggccgcagctatcctggatgcaaatgagtcccatcaaact
gacacggcctcccaagtcaaggacaatacgcctctcgttgaacggtttgagaccttttgc
ctggacccttcccttgtcaccaagcaggccagcctcgtgcacttcccccccggattccag
cccatcccctgcaagcctctgttctttgacctggccctcaaccacgtggccttcccacct
cttgaggacaaattggagcagaagaccaagagcggcctcacaggctacatcaagggcatc
tttggtttcaggagctaa

DBGET integrated database retrieval system