KEGG   Rattus norvegicus (rat): 363720
Entry
363720            CDS       T01003                                 

Gene name
Chmp2b, RGD1306781
Definition
(RefSeq) charged multivesicular body protein 2B
  KO
K12192  charged multivesicular body protein 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04217  Necroptosis
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    363720 (Chmp2b)
  09143 Cell growth and death
   04217 Necroptosis
    363720 (Chmp2b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    363720 (Chmp2b)
   05022 Pathways of neurodegeneration - multiple diseases
    363720 (Chmp2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363720 (Chmp2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    363720 (Chmp2b)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    363720 (Chmp2b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   363720 (Chmp2b)
SSDB
Motif
Pfam: Snf7 DnaJ-X
Other DBs
NCBI-GeneID: 363720
NCBI-ProteinID: XP_001063932
RGD: 1306781
Ensembl: ENSRNOG00000040257
UniProt: F1M8B7
Position
11p12
AA seq 213 aa
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRV
LAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQK
TLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAK
APSAARSLPSASTSKATISDEEIERQLKALGVD
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgtccctcttcaagaagaagaccgtggacgatgtcataaaggagcagaatcgagag
ctgcggggcacacagagggccataatcagggaccgagcagccttagagaaacaggagaaa
cagctggagttagaaattaagaagatggccaagattgggaataaagaagcttgcagggtt
ttagctaagcagcttgtccatctacggaaacagaagacaagaacatttgctgtaagctca
aaagtcacatctatgtccacacaaacgaaagtgatgaattcccagatgaagatggccggt
gccatgtctaccactgcaaagacgatgcaagcagtgaacaagaaaatggatccacagaag
acactacaaacaatgcagaatttccagaaggaaaacatgaaaatggaaatgactgaagaa
atgatcaacgacaccctggatgacatctttgatggctctgatgatgaagaggaaagccag
gacatcgtgaatcaagttcttgatgaaatcggaattgaaatctctggaaagatggccaaa
gccccatcggctgccagaagtttgccatctgcttctacttcaaaggctacaatttctgat
gaagagattgaacggcagctcaaagctttgggggtagattag

DBGET integrated database retrieval system