KEGG   Rattus norvegicus (rat): 363790
Entry
363790            CDS       T01003                                 

Gene name
Fbxo40
Definition
(RefSeq) F-box protein 40
  KO
K10315  F-box protein 40
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    363790 (Fbxo40)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     363790 (Fbxo40)
SSDB
Motif
Pfam: F-box_4 zf-TRAF_2 F-box-like F-box GHL5
Other DBs
NCBI-GeneID: 363790
NCBI-ProteinID: XP_006248466
RGD: 1309781
Ensembl: ENSRNOG00000002459
UniProt: F1LXQ1
Position
11q21
AA seq 710 aa
MGRARRPPPALHRHCEGCIDRHCRVPAEPSVSCLVISCHLLCGATFHMCKESEHTLLCPL
EQVPCLNSEYGCPLSMARHKLAKHLQVCPASVVCCSMEWNRWPNVDSETVLHENIMKESP
SEECLDTALALQDQKVLFRSLKMVELFPETRDATEEEPAMNGDTSWEETAGAVGGVDAGL
VPNSCLPATNGQTMELSQEERDALAKTKEGMDLDKFGKWESMFSKEHAASVLTGSSGKSE
DKNENVSGKEQRSGDGSTGDAECSTERRGPQESPKPQEPPTTIEMTGLAPWQDGVLERLK
TAVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVYTFKIPVSYCGK
RARLGDAMLRCRPSEHKAVDTSDLGISVEDLPKSDLIKTTLQCALERELKGHVISESRSI
DGLFMDLATQTYNFESEQFSSETVLADLLGTTQSGGLHVELHSECVTRRHNKSSSAFTFT
CNKFFRRDEFPLHFKNVHTDIQSCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQ
ELKTFAIKPEVAPELSEKWKSDHLSGRDGKSLNSLTSLPLEVLQYIAGFLDSISLSQLSQ
VSVLMRNICATLLQERGMVLLQWKKKRYSHGGTSWKVHNQIWQFSSLFSKIKSWEFNDVT
SMSEHLKTCPFNVVEHKTDPIRLTSMCQPQEQARESLVSTFRARPRGRHS
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgggccgagcacgcaggcctccacctgcactgcacaggcactgcgagggatgcatcgac
cgccactgccgtgttccagcggagcccagcgtctcctgcctggtgataagctgtcacctg
ctctgtggcgctaccttccacatgtgcaaagagtcagagcatacgctcctctgccctctg
gaacaggttccgtgcctcaactctgagtatggctgcccgctctccatggcacgccacaaa
ctggctaagcacctgcaggtgtgccccgccagcgtggtctgctgctccatggaatggaac
cgctggccaaacgtggactcggaaacagtccttcatgagaacatcatgaaagagagcccc
agcgaggagtgtttggatacagccctggccctccaagatcagaaggttctcttcagatcc
ttgaaaatggtagagctttttccagaaaccagagacgccaccgaggaggagccagccatg
aatggcgataccagttgggaggagactgcgggcgcagtcgggggcgtggatgcagggcta
gtaccaaactcttgtttgccggcaaccaatgggcaaacgatggagctcagtcaggaggaa
cgagatgcattggccaaaaccaaagaagggatggacctggacaagtttggcaagtgggaa
agtatgttcagcaaggagcacgcagcctctgttttaacaggttcctcggggaaaagtgaa
gacaagaatgagaatgtgtctgggaaagagcagcgctctggtgatggtagcacaggggat
gcagagtgttctaccgaaaggagaggaccacaggaaagcccgaagccccaggaacctccc
accaccattgagatgacagggcttgctccctggcaagatggcgttctggaaagactaaaa
acagcagtggacgccaaagactataacatgtatctggtgcacaatggacggatgctcatc
cacttcgggcagatgcctgcttgtacgcccaaggagagagacttcgtttacggcaacctc
gaagctcaagaagtgaagacggtttataccttcaaaattcccgtgagctactgcgggaag
cgagctcgcttgggagatgccatgttgaggtgcagaccaagtgagcacaaggccgtggat
acttccgacttgggcatctctgtggaggacctgcccaaatccgatctcatcaagaccacc
ctccagtgtgctttggaaagagaactcaaaggccacgtcatctctgagtccaggagcatc
gatggactctttatggatctcgccacccaaacatacaactttgagtcagaacagttttcc
tcagagacagtgttggctgacctcctaggcactacccaatccgggggcctgcatgtggag
ctccacagtgagtgtgtgaccagaagacacaacaaaagcagctcagcttttacttttacc
tgcaacaaattcttccggagggatgaatttcccctgcacttcaagaatgtccacaccgac
attcagtcgtgtctcaatggctggttccagcatcgatgccccctcgcctacttgggatgt
acatttgttcaaaaccacttccgcccccctggacaaaaagcaaaagtgatctatagtcag
gagctgaagacctttgccatcaagccagaggttgctccggaactgagcgagaaatggaaa
agcgaccatctctcaggccgcgatgggaaaagcctgaattctctaaccagcctgcccttg
gaggttttgcaatacattgctgggtttctggacagcatcagcctgtcccagttatcccag
gtatcagtactgatgaggaacatctgtgcaacgttgttgcaagagagagggatggtcctc
ttgcaatggaagaagaagaggtattctcatggaggcacctcctggaaagtccacaatcag
atctggcagttcagcagcctcttctcaaaaatcaagagctgggagtttaatgacgtcacc
tccatgtccgaacacctgaaaacctgtcctttcaatgtcgtggagcataagactgacccc
attcgtctgaccagcatgtgccagccccaagagcaggccagggagagcttagtgtccacg
tttagggcccgaccgcggggaaggcactcttaa

DBGET integrated database retrieval system