KEGG   Rattus norvegicus (rat): 363795Help
Entry
363795            CDS       T01003                                 

Gene name
Lmln
Definition
(RefSeq) leishmanolysin like peptidase
  KO
K13539  leishmanolysin-like peptidase [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    363795 (Lmln)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    363795 (Lmln)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     363795 (Lmln)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M8: leishmanolysin family
   363795 (Lmln)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     363795 (Lmln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M8 Acetyltransf_3
Motif
Other DBs
NCBI-GeneID: 363795
NCBI-ProteinID: NP_001102313
RGD: 1311465
Ensembl: ENSRNOG00000001781
UniProt: D4AC69
Position
11q22
AA seq 707 aa AA seqDB search
MPANGEAAEGPPPVRGKGGRQRGGVALHGNDAGPKMAAAGSGVAGGPGPGPRGRWGGCLW
VRGVLLVLGGLPAGAAAAPVSLGTSPPCRHHVLSDTEVINKVHLKTSHVTKRDADGHLRI
KTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTFQVRRPAGRILLSRQCATNQYLRKEN
DPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREGKWPCGAVGVLDPEGVQDADFVLYVG
ALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMISTQPQEFIGMLSTVKHEIIH
ALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSLGLYQWSDKVVRKVERLWNVRDNKIV
RHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGGMGTELNHWEKRLLENEAMTGSHTQN
RVLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCEFVRKSCKFWIDQHRQKRQVPSPYC
DTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELSGISAEDLPYYGGSVEIAD
YCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNYGAEQYGPHSVCLLQKSAFVMEQCER
KLSYPDWGSGCYQVWVQDTSYLCSRAGQVLPVRIQMNGWIHNGNLLCPSCWDFCEQCPPE
TDPPAANLTRALPLDLCSCSSSLVVTLWLLLGNLFPLLAGFLLCVWH
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaatggcgaggcggctgagggcccgccacctgtccgcggcaagggcgggcgg
cagcggggaggcgtcgcactccatggtaacgacgccggcccgaagatggcggccgctggg
tctggagtagcgggcggcccgggaccagggccgcgaggccgctggggcggctgcctgtgg
gtgcgaggcgtcctgctcgtgctgggcgggctcccggccggcgccgcggctgctccagtc
tccctgggcacttcgcctccgtgtcggcatcacgtcctttcggacactgaggtcataaat
aaggtccatcttaagacaagtcatgtcacaaagagagatgcggatgggcatttacgaatc
aagactatctatgatcagagcattgaagagttgctccccgagaaaagatatcttgtaaag
aacaaacttttcccacaagctatttcttatttagagaaaacatttcaggttcgaagacct
gctggcaggatcttacttagcagacaatgtgcgacaaaccagtacctacggaaggaaaac
gatccgcaccgatactgcactggggagtgcgccgtgcacaccaagtgtgggcctgttatt
gtgcccgaggagcacctccagcaatgcagggtctgccgagagggaaagtggccatgtgga
gcggtgggtgtgctagaccctgagggcgtgcaggatgcggactttgttctttacgtaggt
gctctagccactgagagatgcagccatgagaacatcatctcttacgcggcctattgtcaa
caggaggcgaaaatggacaggcccatagcaggatatgctaacctgtgtccaaatatgatc
tccacccagccacaagagtttatcgggatgctgtccacagtgaagcacgagatcattcat
gccctgggcttctcggctgggctctttgcattctaccatgatcaagatgggaaccccctg
acttcaaggtctgcagacggcctcccacccttcaactacagtcttgggttgtatcagtgg
agcgataaagtggttcggaaggtggagagattgtggaatgttcgagataataagatagtt
cgccacactgtgtatctcctagtaacaccgcgtgttgtcgaggaagctcggaagcatttt
aactgcccagtcctagagggaatggagcttgaaaaccaaggtggcatgggcacagagctc
aaccactgggagaagcgcttgctagagaatgaagcaatgactggttctcacacccagaac
agagtcctgtctcgaatcaccctggcattaatggaggacactggctggtacaaagcaaat
tacagcatggctgagaaactcgactggggccgaggaatgggctgtgaatttgtcaggaag
agctgtaaattctggatcgatcagcacaggcaaaagaggcaggtgccgagcccgtactgt
gacacgctcaggagtaacccgctgcagctgacttgccgacaggaccagagagccgtcgct
gtgtgtaacctgcagagatttcccaaccccttaccaccagagtaccagtactttgatgag
ctcagtgggatatctgccgaggatctgccttactatggtgggtcagtcgaaatcgctgac
tattgccctttcagtcaggaattcagctggcatttaagtggcgagtaccagcgcagctcc
gactgtagaatactggaaaaccaaccagagctgtttaagaactacggtgcagagcagtac
gggccgcattcagtctgtctgcttcagaagtcagcgtttgtcatggagcaatgtgagagg
aagctcagctacccagactgggggagcgggtgctaccaggtttgggttcaagacacctca
tatctgtgtagccgggcagggcaggtcctcccggttcgaattcagatgaatggctggatt
cacaatggaaacctactgtgcccctcctgctgggacttctgtgagcagtgtccaccagaa
acagaccctccagctgccaacctgacccgagcccttcctctggatctctgctcctgttct
tctagcctggttgtcacgctttggctcctcctcggcaatctgttccctctgctggccgga
ttccttctgtgtgtttggcactag

DBGET integrated database retrieval system