KEGG   Rattus norvegicus (rat): 363823Help
Entry
363823            CDS       T01003                                 

Gene name
Map6d1, RGD1560102
Definition
(RefSeq) MAP6 domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 363823
NCBI-ProteinID: NP_001102314
RGD: 1560102
Ensembl: ENSRNOG00000001911
UniProt: D3ZT16
Position
11q23
AA seq 191 aa AA seqDB search
MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYPDPGSEEPGADCSVSRGSPSVAGAREP
SRAVPLTQYQRDFGVRTARAGSRDAAQERAPGPGGRRGQSSAPPTRTVYVLPVGDADATV
VATTSYRQEFQAWTGVKPSRSTKARAARVVTTHSSGWDPSPGASFQVPEVRKFTPNPSAI
FQTSAPQALHV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggccctgcatcagccggctgtgctgcctggcccggcgctggaaccagctggac
cgctcggacgtagcggtgccgctgactctgcacggttacccggacccggggagcgaggag
ccaggcgcggactgcagcgtctcgcgcgggagcccgtccgtcgccggcgcgcgggagccc
agccgtgccgtgccgctcacccagtaccagcgcgatttcggtgtgcgaactgctcgcgcg
gggtcccgggatgctgctcaagagcgcgcaccggggccgggcggccgcaggggccagtcc
tcggcgcccccaacccggacggtctacgtgctgccggtcggggacgcggacgcaactgta
gtagcgaccacgtcttatagacaggaattccaagcttggactggagtgaagccctcaaga
tccacaaaggcaagagcagccagagttgtcacgactcacagctccggatgggaccccagc
cctggggccagcttccaggttccagaggtgaggaaattcacaccaaacccctcagccatc
tttcagacatcagcccctcaggcgctccatgtgtga

DBGET integrated database retrieval system