KEGG   Rattus norvegicus (rat): 363854
Entry
363854            CDS       T01003                                 

Gene name
Elavl1, HuR, Hua
Definition
(RefSeq) ELAV like RNA binding protein 1
  KO
K13088  ELAV-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    363854 (Elavl1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    363854 (Elavl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    363854 (Elavl1)
   03041 Spliceosome [BR:rno03041]
    363854 (Elavl1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     363854 (Elavl1)
   mRNA cycle factors
    Stress granule specific factors
     363854 (Elavl1)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    363854 (Elavl1)
SSDB
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_occluded RRM_3 E2
Other DBs
NCBI-GeneID: 363854
NCBI-ProteinID: NP_001102318
RGD: 1308649
Ensembl: ENSRNOG00000001069
UniProt: B5DF91
Position
12p12
AA seq 326 aa
MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
VKFAANPNQNKNMALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGISGVNVPGNA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtctaatggttatgaagaccacatggcggaagactgcagggatgacattgggagaacg
aatttaattgtcaactacctccctcagaacatgacccaggaggaactacggagtctgttc
agcagcattggcgaggttgaatctgcaaaacttattcgggataaagttgcaggacacagc
ttgggctacggctttgtgaactatgttactgcaaaagatgcagagagagcaatcagcaca
ctgaacggcttgaggcttcagtccaaaaccattaaggtatcatatgctcgcccaagctca
gaggttatcaaagatgccaacttgtacatcagtgggcttccaaggaccatgactcagaag
gatgtggaagacatgttttctcggtttgggcgaatcatcaactccagggtccttgtggat
cagaccacaggtttgtccagaggggttgcctttatccggtttgacaaacggtctgaagca
gaagaggcaattaccagtttcaatggtcataaacccccgggttcctccgagcccatcaca
gtgaagtttgcagccaatcccaaccagaacaaaaacatggctctcctctcgcagctgtac
cactcgcctgctaggaggtttggaggccctgtgcatcaccaggcacagagattcaggttc
tcccctatgggtgtagatcacatgagtgggatttctggtgtcaatgtccccggcaatgct
tcctcgggctggtgcatcttcatctacaaccttgggcaagacgccgatgaggggatcctc
tggcagatgtttggcccctttggtgcagttaccaatgtgaaagtgattcgtgatttcaac
accaacaagtgcaaagggtttggttttgtgaccatgacaaactatgaagaagctgcaatg
gccatagcaagtctgaacggctaccgcctgggggacaaaattttacaggtttccttcaaa
accaacaagtcccacaaataa

DBGET integrated database retrieval system