KEGG   Rattus norvegicus (rat): 363855Help
Entry
363855            CDS       T01003                                 

Gene name
Map2k7, JNKK, Jnkk2, Mapkk7, Mek7, Mkk7
Definition
(RefSeq) mitogen activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04380  Osteoclast differentiation
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04926  Relaxin signaling pathway
rno05016  Huntington disease
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05161  Hepatitis B
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    363855 (Map2k7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    363855 (Map2k7)
   04012 ErbB signaling pathway
    363855 (Map2k7)
   04668 TNF signaling pathway
    363855 (Map2k7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    363855 (Map2k7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363855 (Map2k7)
   04660 T cell receptor signaling pathway
    363855 (Map2k7)
   04664 Fc epsilon RI signaling pathway
    363855 (Map2k7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    363855 (Map2k7)
   04926 Relaxin signaling pathway
    363855 (Map2k7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    363855 (Map2k7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    363855 (Map2k7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    363855 (Map2k7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    363855 (Map2k7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    363855 (Map2k7)
   05135 Yersinia infection
    363855 (Map2k7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    363855 (Map2k7)
   05161 Hepatitis B
    363855 (Map2k7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    363855 (Map2k7)
   05169 Epstein-Barr virus infection
    363855 (Map2k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363855 (Map2k7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     363855 (Map2k7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   363855 (Map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 363855
NCBI-ProteinID: NP_001020596
RGD: 1560043
Ensembl: ENSRNOG00000001047
UniProt: Q4KSH7
Position
12p12
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPSRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKHYETLEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcaaaagctgtcccgcctggaggccaagctgaagcaggag
aatcgtgaggcccgcaggaggatcgacctcaacctggatataagcccacagcggcccagg
cccaccttgcagctcccactggccaacgatgggggcagccgctcaccatcctcagagagc
tccccacagcaccctacgccccccagccggccccgccacatgctggggctcccgtcaacc
ttgttcacacctcgcagtatggagagcatcgagattgaccaaaagctgcaggagatcatg
aagcagacagggtacctgactatcgggggccagcgttatcaggcagaaatcaatgacttg
gagaacctgggagagatgggcagtggtacctgtggtcaggtgtggaagatgcggttccgg
aagacaggccacatcattgctgttaagcaaatgcggcgctcggggaacaaggaagagaat
aagcgcatcctaatggacctggacgtagtactcaagagccacgactgcccctacattgtt
cagtgctttggtaccttcatcaccaacacggacgtctttattgccatggagctcatgggc
acgtgtgcggagaagctgaagaaacggatgcagggccccatcccagagcgaatccttggc
aagatgaccgtggcgattgtgaaagcattgtactatctgaaggagaagcatggggtcatc
catcgtgatgtcaaaccctccaacatcctgctggatgagcggggtcagatcaagctctgt
gactttggcatcagtggccgccttgttgactccaaagccaaaacacggagtgctggctgt
gctgcctatatggctcctgagcgcattgacccgccagaccccaccaagccagactatgac
atccgggccgatgtgtggagcctgggcatctcactggtggagctggcaacaggacagttc
ccctataagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgctcctgcctggtcacatgggcttctcaggggacttccagtcatttgtcaaagactgc
cttactaaagaccacaggaagagaccaaagtataacaaactacttgaacacagcttcatc
aagcactatgagacactcgaagtggatgtcgcgtcctggtttaaggacgtcatggcaaag
accgagtccccaaggactagtggagtcctgagccaacaccatctgcccttcttcaggtag

DBGET integrated database retrieval system