KEGG   Rattus norvegicus (rat): 363856Help
Entry
363856            CDS       T01003                                 

Gene name
Cd209d, Clec4m, Dc-signr, RGD1561104
Definition
(RefSeq) CD209d antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    363856 (Cd209d)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    363856 (Cd209d)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    363856 (Cd209d)
  09172 Infectious disease: viral
   05162 Measles
    363856 (Cd209d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363856 (Cd209d)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    363856 (Cd209d)
   04090 CD molecules [BR:rno04090]
    363856 (Cd209d)
   04091 Lectins [BR:rno04091]
    363856 (Cd209d)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    363856 (Cd209d)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   363856 (Cd209d)
CD molecules [BR:rno04090]
 Proteins
  363856 (Cd209d)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    363856 (Cd209d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 HERV-K_REC TRP
Motif
Other DBs
NCBI-GeneID: 363856
NCBI-ProteinID: NP_001102319
RGD: 1561104
Ensembl: ENSRNOG00000001017
UniProt: D3ZXN3
Position
12p12
AA seq 237 aa AA seqDB search
MSESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLS
FLFLAGLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFF
SKSQRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVD
GSPLSPSFAQYWNRGEPNNVGDEDCAEFSGDGWNDLRCDTRIFWICKKVSTSSCTIK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtccatggaatcaaacacacagcaactggacaatccagaggatgaagagtat
ttgatgagtggttccaggtattctattatcagctctcgattacgaacaaaatttggaatc
aaaagtttggcagaatatacgaagcagagccacaaccccttggtcctaccgctgctctcc
ttcctgttcttggctggccttctgctgatcattcttgtcctagtctcaaaggtacccagc
tcagaagttcaggacaaaatctaccaggagctcatgcaactgaagactgaagtccatgat
ggcttgtgtcaaccctgtccgagggattggacattcttcaatggaagctgttacttcttc
tccaagtcccaaagaaactggcacaactccatcactgcctgcaaggaactgggggctcaa
ttggtcatcgtagagacggatgaagagcagaccttcctgcagcagacttctaagactagg
ggaccaacatggatgggtctctcagacatgcataatgaagccacgtggcactgggtggat
ggctcacctctgtcacccagctttgcacagtattggaatagaggggagcccaacaatgtc
ggtgatgaggattgtgcagagttctctggggacggctggaatgacctcagatgcgatacc
cggattttctggatctgtaagaaagtttcaacctcatcatgtaccatcaaatga

DBGET integrated database retrieval system