KEGG   Rattus norvegicus (rat): 363866
Entry
363866            CDS       T01003                                 

Gene name
Rxfp2, Gpcr, Lgr8
Definition
(RefSeq) relaxin/insulin-like family peptide receptor 2
  KO
K04307  relaxin family peptide receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    363866 (Rxfp2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    363866 (Rxfp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    363866 (Rxfp2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Relaxin
    363866 (Rxfp2)
SSDB
Motif
Pfam: LRR_8 7tm_1 LRR_5 LRR_4 Ldl_recept_a LRR_9 LRR_1
Other DBs
NCBI-GeneID: 363866
NCBI-ProteinID: NP_001012493
RGD: 1309449
Ensembl: ENSRNOG00000000897
UniProt: Q5ECL0
Position
12p12
AA seq 737 aa
MWLLLHVVLLMEVKDFTLAGSNMVAPLCPKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE
DNCGDTSGWTTIFGTVHGNVNKVTLTEECFLSRYPQHCYCRENELECVNADLKAVPKVSS
NVTLLSLKKNKIHRLPVKVFSKYAELRKIFLQHNCITHISRRAFLGLHNLQILYLSHNCI
TSLRPGIFKDLHQLAWLILDDNPITRISQRSFTGLNSLFFLSMVSNRLEALPERLCAQMP
QLNWVDLANNGIKFITNSTFLTCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNVI
AKLPAHLFSDLHLLQKLNLSSNPLLYVHKNQFGSLKQLQSLDLERIEIPNINTGMFRPMK
NLSHIYLKTFRYCSYVPHVRICMPSTDGISSSEDLLANSILRVSVWVIAFITCAGNFLVI
AVRSLIKAENTTHAMSIKILCCADCLMGVYLFSVGVFDIKYRGQYQKYALLWMESVPCRL
LGFLATLSTEVSVLLLTFLTLEKFLVIVFPFSNLRLGKRQTAVVLASIWVAGFLIAAVPF
TSEDYFGNFYGKNGVCFPLHYDQAEDFGSRGYSLGIFLGVNLLAFLVITFSYVTMFCSIQ
KTALQTAEVRSHIGKEVAVANRFFFIVFSDAICWIPVFVVKILSLLQVEIPGTITSWIVV
FFLPVNSALNPILYTLTTSLFKDKLKQLLHKHRRKSIFKVKKKSLSASIVWTDDSSLKLG
VLNKIALGDSIMKPVSP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgtggcttctacttcatgtcgtccttctgatggaggtcaaagatttcacactggctggc
agcaatatggtggctcctctgtgcccaaaagggtatttcccctgtgggaatctcaccaag
tgcttaccccgagcctttcactgcgacggcgtggatgattgcgggaatggtgcggatgag
gacaactgtggtgacactagtggatggacgaccatatttggcacagtccatggaaatgtc
aataaagtgacattaacagaggagtgctttctcagccggtacccacagcactgttactgc
agagaaaatgaactagaatgcgtaaacgccgacttaaaagctgtgccaaaggtttccagc
aacgtaacattactatctcttaagaaaaacaaaattcacagacttccagtcaaggttttc
agcaaatacgcagaactcagaaagatattcctccagcacaactgcatcacacacatctcc
aggagagcgttccttggattacataacctacagatactgtatctcagccataactgcatt
acctctctcaggcctgggatattcaaagacttgcatcagctcgcttggctaattttagat
gacaacccaatcaccagaatctcacagaggtcctttactggattaaactccttgtttttc
ttgtccatggtgagtaaccggctggaggcccttcctgaaaggctgtgcgcccagatgcct
caactcaactgggtggatctggcaaacaatgggataaagttcataacgaactccaccttc
ctgacgtgcgactcgctcacggttctgtttctgcctagaaatcaaattggttttgttcca
gagaagacattttcttcattaaaaaatttaggagaactggacctgtctagcaatgtgata
gcaaaactaccagcccaccttttcagcgaccttcaccttctccaaaagctgaacctgtcg
tccaaccctcttctgtatgtccacaagaaccagtttggaagtctcaaacaacttcagtct
ctagacctggaaaggatagagattccaaacataaacaccggaatgttccggcccatgaag
aacctttctcacatatatttgaaaacctttcggtactgctcctatgttccccatgtccga
atctgtatgccctcgactgatggtatatcttcatctgaggacctcttggctaacagtatc
ctcagagtgtctgtctgggttatagctttcattacctgcgctgggaatttcctcgtcata
gccgtgagatctctcattaaggctgagaatacgactcacgctatgtccatcaaaatcctt
tgttgtgccgactgcctgatgggggtgtacctgttctccgtgggcgtctttgacatcaag
taccgagggcagtatcagaagtatgcgctgctgtggatggagagtgtaccctgccgcctg
ctgggcttcctggccacgctgtccacagaggtctcggtgctgctgctgacattcctgacc
ctggagaagttcctggtcatcgtattccctttcagcaacctgcgcctgggcaagcgtcag
acggccgtggtcctcgccagcatctgggtggcgggatttctcatagcggccgttcccttc
accagcgaggattattttggcaacttttatgggaaaaacggagtctgcttcccacttcat
tacgaccaagcagaagattttggaagtagagggtactcccttgggattttcctaggcgtg
aacttgctggctttcctcgtcatcacgttctcctatgtcaccatgttctgctccattcag
aaaacagccctccagactgcagaagtgaggagccacatcgggaaggaggtggctgtcgcc
aaccggttctttttcatcgtgttctctgacgccatctgctggattcctgtgtttgtcgtt
aaaatcctgtctctccttcaagtagagataccaggcacaatcacttcctggatcgtggtt
tttttccttccggtaaacagcgccttaaaccccatcctctacactctcaccacctccctt
tttaaggacaagttgaaacagttgctgcacaaacatcggaggaaatccattttcaaagtt
aagaagaaaagtctatctgcttccattgtgtggacagatgactcttcacttaaacttgga
gtgttgaacaaaatagcccttggggacagtataatgaagccggtctccccgtag

DBGET integrated database retrieval system