KEGG   Rattus norvegicus (rat): 363991
Entry
363991            CDS       T01003                                 

Gene name
Ascl5, RGD1561854
Definition
(RefSeq) achaete-scute family bHLH transcription factor 5
  KO
K09067  achaete-scute complex protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    363991 (Ascl5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    363991 (Ascl5)
SSDB
Motif
Pfam: HLH Cas9-BH
Other DBs
NCBI-GeneID: 363991
NCBI-ProteinID: XP_017454536
RGD: 1561854
Ensembl: ENSRNOG00000033391
UniProt: F1LUI6
Position
13q13
AA seq 188 aa
MNSNFCRALVDRGSPGGIQLGVVAPAGPTPLAATEPLGNVPFLLYPGHSEPSYYDAYTGV
FPYVPFPGAFGVYDYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLPGALAEKRLSKVE
TLRAAIRYIKYLQELLSAAPDGAPPTATSPPPAHAGHGNALQPPSLVAESSGSSFSPSPF
LESEEPSL
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaacagtaacttctgtcgagctctggtggaccgcgggtccccggggggcatacagctg
ggtgtcgtggcccctgcaggaccgacgccgctggcagccactgagcccctgggcaacgta
ccctttctgttatacccgggacactccgagccgtcttactacgatgcctacactggggtg
ttcccctacgtgcccttccccggtgccttcggggtttacgactacccgttcgagcccgcc
ttcatccagaaacgcaacgagcgcgagcggcagcgggtcaagtgcgtgaacgagggctat
gcgcgcctccgcggccacctccctggtgccctggctgaaaagaggctcagcaaggtggag
acactgcgcgccgccatccgctacatcaagtacttgcaggagctgctgagtgcggccccc
gatggcgcgccacccaccgccacctccccgccgcccgcccacgccggccacggtaacgcg
ctgcagcccccctccctggtggccgagtccagtgggtcctccttttcgccttcgcctttt
ttggagtcggaggaacccagcctttga

DBGET integrated database retrieval system