KEGG   Rattus norvegicus (rat): 363993
Entry
363993            CDS       T01003                                 

Gene name
Gpr25
Definition
(RefSeq) G protein-coupled receptor 25
  KO
K08405  G protein-coupled receptor 25
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    363993 (Gpr25)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    363993 (Gpr25)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 363993
NCBI-ProteinID: XP_001064036
RGD: 1311611
Ensembl: ENSRNOG00000008603
UniProt: D4A7G6
Position
13q13
AA seq 359 aa
MQSTESWNSSWGTTMSWDYSGSGSLDQVELCPAWELPYSHAIISALYLAAFVVGLTGNTF
VVWLLSRRRRPRRLVDTFVLHLAAADLGFVLTLPLWAVAEARGGLWPFGDGLCKISSFAL
AATRCAGALLLAGMSVDRYLAVGRPLNARPLRSARCVRASCSAVWAAAFLAGLPTLLYRR
LQPSLDGEGSQCAEEPSDALQGVGLLLLLLTFALPLAVTLTCYWRVSRRLLRVRRARGNS
LRIIFTVESVFVGSWLPFSILRALFYLARLRALPLPCSLLLALRWGLTVATCLAFVHSCA
NPVIYLLLDRSFRARVRFGPCTRVGRQVRRISSASSLSRDDSSVFWGRSSKANSALAAW
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcagtccaccgagtcctggaattctagctggggcaccacgatgtcctgggactattcg
ggctcaggctccctggaccaagtagagctgtgccctgcctgggaactgccttacagccac
gccatcatctccgcgctctacctggcggccttcgtcgtgggcctgacgggcaacaccttc
gtggtgtggctgctgagccggcggcgccgaccgcggcggctggtggacaccttcgtactg
cacttggcggccgcggacctgggcttcgtgctcacgctgccactgtgggctgtggcggag
gcgcgcggcggcctctggcccttcggcgatggcctgtgcaaaatcagcagcttcgcgctg
gcggccacacgctgcgcgggcgcgctgctgctggcgggcatgagcgtggaccgctacctg
gccgtaggccggccgctgaacgcgcgcccgctgcgcagcgcgcgctgtgtgcgagcctcg
tgcagcgccgtctgggctgcggcgttcctcgccggtctgcccaccttgctctaccggagg
ttgcagccgagcctggacggcgagggcagccagtgcgcggaggagccctcggatgcgctc
cagggtgtcgggctgttgctgctgctactgaccttcgcgctgccgctggctgtcaccctg
acctgctactggcgcgtgtcgcgccgcctgctacgcgtccgtagggcccgaggcaactcg
ctgcgtatcatcttcaccgtggagagcgtcttcgtgggctcctggttgcccttcagcatc
ctgcgcgctcttttctacctggcgagactccgggcgctgccgctgccctgctccctgctg
ctggcgctgcgttggggtctgactgtcgccacctgcctagctttcgtccacagctgtgcg
aacccggtcatctatctcctgctggaccgctcgttccgcgcccgggtccgattcgggccg
tgcacgcgcgtcgggcgacaggtgcgcaggatcagctcggcctcctcgctctccagagat
gacagctcggtgttctggggccgatcctcaaaggcgaactctgctttggccgcttggtag

DBGET integrated database retrieval system