KEGG   Rattus norvegicus (rat): 364033
Entry
364033            CDS       T01003                                 

Gene name
Vamp4
Definition
(RefSeq) vesicle-associated membrane protein 4
  KO
K08513  vesicle-associated membrane protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    364033 (Vamp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    364033 (Vamp4)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    364033 (Vamp4)
SSDB
Motif
Pfam: Synaptobrevin MCU Fzo_mitofusin Sec5 TFR_dimer NPV_P10
Other DBs
NCBI-GeneID: 364033
NCBI-ProteinID: NP_001102326
RGD: 1309753
Ensembl: ENSRNOG00000003071
Vega: OTTRNOG00000000207
UniProt: D4A560
Position
13q22
AA seq 141 aa
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQV
DEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIM
ALAAAILLLMIITQIILHLKK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgcctcccaagttcaagcgccacctaaatgacgatgacgtcactgggtctgtgaaaagt
gagaggagaaatcttttggaagatgattcagatgaagaagaggacttttttctacgggga
ccatctggaccaagatttggacccagaaacgataaaattaagcatgttcagaatcaggtg
gacgaagttattgatgtaatgcaagagaatattaccaaggtaattgaaagaggagagagg
ctagatgaactacaggacaaatcagaaagcttatcggataatgcaactgctttcagcaac
agatccaaacagcttcgaaggcaaatgtggtggcgtggatgcaaaataaaagccatcatg
gctttggctgcagctatccttttgctaatgattatcactcagatcatcctgcacttgaaa
aaatga

DBGET integrated database retrieval system