KEGG   Rattus norvegicus (rat): 364064
Entry
364064            CDS       T01003                                 

Gene name
Pycr2
Definition
(RefSeq) pyrroline-5-carboxylate reductase family, member 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    364064 (Pycr2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     364064 (Pycr2)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Other DBs
NCBI-GeneID: 364064
NCBI-ProteinID: NP_001012208
RGD: 1310074
Ensembl: ENSRNOG00000003267
UniProt: Q6AY23
Position
13q26
AA seq 320 aa
MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPEMDLPTVSALRKMGVNLTRSNKDTV
RHSDVLFLAVKPHIIPFILDEIGADVQERHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAY
AFMALDALADGGVKMGVPRRLAVRLGAQALLGAAKMLLDSEDHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKVSPAALKKTLLDRVKLESPTVSTL
APPSSGKLLTRNPAQGSKRE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgagcgtgggtttcatcggcgcgggccagctggcctgtgctctggcgcggggcttcacg
gccgcgggcgtcctgtcggctcacaagataatagccagctccccggaaatggacctgccc
acggtgtctgcgctcaggaagatgggtgtgaatctgacccgaagcaataaggacacggtg
cggcacagtgacgtcctgttcctggctgtgaagccccacatcatccccttcatcctggat
gagatcggggctgacgtgcaggagaggcacatcgtggtctcctgtgcggctggcgtcacc
atcagttctgtggagaagaagctgatggctttccagccagcccccaaagtgatccgctgc
atgaccaacacgcctgtggtggtccgagagggggccactgtgtacgccacaggcacccat
gctctggtggaagatgggaagcttctggagcagctgatgagcagtgtgggcttctgcaca
gaggtggaggaagacctcattgatgctatcacagggctcagcggcagcgggcccgcctac
gcgtttatggccctggatgcgctggcagacggcggggtgaagatgggcgtgccgcggcgc
ctggcagtccgactgggagctcaggcgttgctgggagcagctaagatgctgctggattca
gaggaccacccgggccagctcaaggacaacgtctgctcccctgggggggccaccatccat
gccctgcacttcctggagagtgggggcttccgctctctgctcatcaatgcagttgaggcc
tcctgtattcgaacaagagagctgcagtccatggctgaccaagaaaaggtgtcccctgcc
gcccttaagaagaccctcctggacagagtgaagctggagtcacccacggtgtccacgctg
gccccacccagctcagggaaactccttacaagaaaccctgcccagggaagcaagagggag
tga

DBGET integrated database retrieval system