KEGG   Rattus norvegicus (rat): 364081
Entry
364081            CDS       T01003                                 

Gene name
Irf6
Definition
(RefSeq) interferon regulatory factor 6
  KO
K10154  interferon regulatory factor 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    364081 (Irf6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    364081 (Irf6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    364081 (Irf6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   364081 (Irf6)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 364081
NCBI-ProteinID: NP_001102329
RGD: 1309645
Ensembl: ENSRNOG00000005082
UniProt: D4AAV0
Position
13q27
AA seq 467 aa
MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAW
AVETGKYQEGVDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQ
GSVINPGSTGSAPWDEKDNDVDEDDEEDELEQSQHHVPIQDTFPFLNINGSPMAPASVGN
CSVGNCSPESVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQT
MTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDR
GLILEVSGHAIYAIRLCQCKVYWSGPCAPSLAAPNLIERQKKVKLFCLETFLSELIAHQK
GQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR
LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPAPSMQLPPALPAQ
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccctccaccctcgaagagtccggctgaagccctggctggtggcccaggtggacagt
ggcctctaccctggtctcatctggctacatagagattccaaacgcttccagatcccctgg
aaacatgccacgcggcacagcccccaacaagaggaagaaaacaccatttttaaggcttgg
gctgtggagactggaaagtaccaggaaggggtggacgatcctgacccagctaaatggaag
gctcagctccgatgtgctctcaacaaaagccgggaattcaacttgatgtatgacggcacc
aaggaagtgcccatgaatcctgtgaagatctatcaagtgtgtgacatcccccagccccag
ggctctgtcattaacccaggatccacagggtctgctccttgggatgagaaagataatgat
gtggatgaagatgacgaggaagatgaacttgaacagtcacagcaccacgtcccgatccag
gacaccttccccttcctgaacatcaatggttctcccatggcaccagccagcgtgggcaac
tgcagtgtgggaaactgcagccctgaatcagtgtggcccaaaacagaacctctggaaatg
gaagtaccgcaggcacccattcagcccttctatagttctccagagctgtggatcagctcc
ctccccatgactgacttggacatcaagtttcagtatcgtgggaaggagtatgggcaaacc
atgacggtgagcaacccccagggctgccggctcttctatggggacctgggccccatgcct
gaccaggaggagctctttggtcctgtcagcctggagcaggtcaagttcccggggccagag
catatcaccaatgagaagcagaagctgttcaccagtaagctgttggatgtcatggacagg
ggactgatcctggaggtcagcggacatgccatttatgccatccggctgtgccagtgcaaa
gtgtactggtcggggccgtgtgccccctcacttgctgctcctaacctgattgagaggcag
aagaaggtcaagttgttttgtctggaaacattcctgagtgagctcattgcccatcagaaa
gggcagatagagaagcagccacctttcgagatttacttatgcttcggggaagaatggcca
gatggaaagcccctggagaggaagctcatcttggtccaggtcattccagtggtggctcgc
atgatctatgagatgttttctggtgatttcacccggtcctttgacagtggcagtgttcgc
ctgcagatttccactccagacatcaaagataacatcgtcgctcagctcaagcagctgtac
cgcatccttcaaacccaggagagctggcagcccatgcagcctgcccccagcatgcagctg
ccgcctgccctgcctgcccagtga

DBGET integrated database retrieval system