KEGG   Rattus norvegicus (rat): 364241
Entry
364241            CDS       T01003                                 

Gene name
Kcnk5, TASK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 5
  KO
K04916  potassium channel subfamily K member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    364241 (Kcnk5)
  09157 Sensory system
   04742 Taste transduction
    364241 (Kcnk5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    364241 (Kcnk5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   364241 (Kcnk5)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 364241
NCBI-ProteinID: NP_001034605
RGD: 1564985
Ensembl: ENSRNOG00000047005
UniProt: Q2KTA6
Position
15p16
AA seq 503 aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLSQEGLDKI
LQVVSDAADQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTRRGVSLRKAQITCTAIFIVWGVLVHLVIPPF
VFMVTEEWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGERVPGPGHGLGAQGGDGLPSIPASLAPLVVYSKNRVPSLEE
VSQTLRNKGHVSRPLGEDAAAQTPKEGYPTSEVFINQLDRISEEGEPWEALDYHPLIFQN
ANITFENEETGLSDEETSKSSVEDNLTSKEQPQPGPMTEVPSSSTGEFPSSDESTFTSTE
SELSVPYEKLMNEYNKADSPRGT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtggaccggggtcccttactcacctcggccatcatattctacctggccatcggggcg
gcgatcttcgaagtgctggaggagccacactggaaggaggccaagaaaaactactataca
cagaaactgcatctactcaaggagtttccgtgcctgagtcaggagggcctggacaagatc
ctacaggtggtgtctgatgctgcggatcagggcgtggccatcaccgggaaccagactttc
aacaactggaactggcccaatgcgatgattttcgcagccacagtcatcaccaccatcggt
tatggtaatgtggctcccaagaccccagctgggcgcctcttctgtgtcttctatggcctg
ttcggggtgccactgtgcctgacatggatcagtgccctgggcaagttcttcgggggacgt
gccaagaggctgggccagtttcttacaaggagaggagtgagcctgaggaaggctcagatc
acatgtacggccatcttcatcgtgtggggcgtcctggtccacctggtgatcccgcccttc
gtgttcatggtgacggaagagtggaactacattgagggcctctactattccttcatcacc
atctccaccattggctttggggactttgtggccggtgtgaaccccagtgccaactaccac
gccctctaccgctactttgtagagctttggatctacctggggctggcttggctgtccctc
tttgtcaactggaaggtgagcatgtttgtggaagtacacaaagccatcaagaagaggagg
aggcggcggaaggaatccttcgagagctccccacactcccggaaggccctgcagatggcc
ggaagtacggcttccaaggacgtcaacatcttcagcttcctatccaaaaaggaggagacc
tataatgacctcatcaaacagattgggaagaaggcaatgaaaacaagtgggggtggggag
agggtcccaggacccggacacgggctgggagctcaaggcggggatggcttacccagcatc
cctgcatccctggcacctttggtggtctattccaagaatcgagtgcccagtttggaagag
gtatctcagactctaagaaacaaaggacacgtgtcaaggccacttggtgaggacgctgcg
gcacagacccccaaggaaggttacccaacctccgaagtgtttattaaccaactggaccgt
atcagcgaggagggtgagccgtgggaagccctggactaccacccgctcattttccaaaac
gccaacatcacctttgagaacgaagaaaccggcctctctgatgaggagacctctaagtct
tccgtggaggacaacctgacctcaaaggagcagcctcagccggggcccatgactgaggtg
ccctcgagcagcacgggtgaattcccttcatcggatgagtccaccttcaccagcactgag
tcagagctctctgtgccttatgagaagctgatgaacgagtacaacaaggcagacagcccc
aggggcacgtga

DBGET integrated database retrieval system