KEGG   Rattus norvegicus (rat): 364403Help
Entry
364403            CDS       T01003                                 

Gene name
Blk
Definition
(RefSeq) BLK proto-oncogene, Src family tyrosine kinase
  KO
K08890  B lymphoid tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    364403 (Blk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     364403 (Blk)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   364403 (Blk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase SH3_16
Motif
Other DBs
NCBI-GeneID: 364403
NCBI-ProteinID: NP_001020922
RGD: 1308859
Ensembl: ENSRNOG00000010798
UniProt: Q4KM97
Position
15p12
AA seq 499 aa AA seqDB search
MGLLSSKRQISEKSKSWSPVKARAQGKVPPPLPPLVVFNHLPPPSPNQHPDEEERFVVAL
FDYAAVNDRDLQVLKGEKLQVLKSTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDVTSQGEMVKHYKIRSLDNGG
YYISPRITFPTLQALVQHYSEKGDGLCQKLTLPCVNPAPKNPWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTRE
PIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANI
LVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYHDVITECWRGRPEERPTFEFL
QSVLEDFYTATEGQYELQP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggctactgagcagcaagaggcagatcagcgagaagagcaagagctggagccctgtg
aaggcccgcgcccagggcaaggtacccccgcccctgccacccctggttgtcttcaaccac
ctccctcctccatctcctaaccagcacccagatgaagaggagcgttttgtggtggccctg
tttgactatgccgctgtgaatgacagggacctgcaagtgctaaagggagagaagctccaa
gtcttgaagagcactggagactggtggttggccaggtcactcgtcacaggaagagaaggc
tatgtgcccagcaactttgtggccccagtagagaccctggaagtagaaaaatggttcttc
aggaccattagccggaaggatgctgagaggcagttgctggctccaatgaacaaagccggc
tcctttctcatcagagagagtgagagcaataaaggtgccttttccctatctgtgaaagac
gtcaccagccagggggagatggtcaagcactataagatccgctcactggacaatggaggc
tattacatctcgccccggatcaccttccccaccctccaggccctggtgcagcactattct
gagaaaggggacggtttgtgtcagaagttgaccctgccctgtgtgaacccagccccgaag
aatccctgggcccaagacgaatgggaaatccccaggcagtccctcaagttggtccggaaa
cttgggtctgggcagtttggtgaagtctggatgggttattacaaaaataacatgaaggtg
gcaatcaagaccctgaaggagggaaccatgtctccggaagctttcctgggtgaggccaac
gtgatgaaaaccctgcagcatgagaggctggtccgtctctacgccgtggtcaccagagag
cccatctacattgtcacggaatacatggccagaggatgcttgctggattttctgaagacc
gatgaaggtagcagattgtcccttccaaggctgattgacatgtcagcccaggttgcagaa
gggatggcttacatagagcgcatgaattccatccaccgtgacctgcgggcagccaacatc
ctggtgtctgagaccttgtgctgcaaaatcgctgacttcggcttggccaggatcatcgac
agtgaatatactgcccaagagggggccaagttccccatcaagtggactgccccagaagcc
atccacttcggggtgtttaccatcaaggctgatgtgtggtcctttggagtcttgctgatg
gagattgtcacatatgggcgtgttccctacccaggaatgagcaaccctgaggtcatccgt
agcctggagcatggctaccgaatgccatgcccagagacatgtccgcctgagttgtaccat
gacgtcatcactgagtgctggcgaggccgacctgaggagcggcctacctttgagttcctg
cagtcagtgctggaggacttctacacagccacggagggccaatatgagctgcagccttag

DBGET integrated database retrieval system