KEGG   Rattus norvegicus (rat): 364420
Entry
364420            CDS       T01003                                 

Gene name
Tnfrsf10b
Definition
(RefSeq) TNF receptor superfamily member 10b precursor
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04650  Natural killer cell mediated cytotoxicity
rno05132  Salmonella infection
rno05164  Influenza A
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    364420 (Tnfrsf10b)
   04061 Viral protein interaction with cytokine and cytokine receptor
    364420 (Tnfrsf10b)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    364420 (Tnfrsf10b)
   04217 Necroptosis
    364420 (Tnfrsf10b)
   04115 p53 signaling pathway
    364420 (Tnfrsf10b)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    364420 (Tnfrsf10b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    364420 (Tnfrsf10b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    364420 (Tnfrsf10b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    364420 (Tnfrsf10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    364420 (Tnfrsf10b)
   04090 CD molecules [BR:rno04090]
    364420 (Tnfrsf10b)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   364420 (Tnfrsf10b)
CD molecules [BR:rno04090]
 Proteins
  364420 (Tnfrsf10b)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 364420
NCBI-ProteinID: NP_001102343
RGD: 1308041
Position
15
AA seq 267 aa
MLQAFLLLSFFVPVTAKLAQDRPADLQRLKQSPLECPAGQYLSKEDGSCKACIDGENYTS
GPNVLPSCLSCRVCKEDKVIKSRCVKARNTECECKPGSFEDKDSTEICQTCSKGCEQDHE
NTVGLSLLDAQTSRKTNGSHHNTEPDRTQSSPLGRKLLVLANGNNPADALKLIFERCSTE
VPFNSWDRLMRHMGLTDNQIQMVRAETQVPCEVLYQMLLKWLYQTGLGASINHLLGALEA
VGERCALEEIEDYAVKSGKFVYQNTTA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgttacaagcttttctgctactgagtttctttgttccagtgactgctaagctagcccag
gatcgcccagctgacctacagaggctgaagcagagtccactggaatgtccagcaggccag
tacctgtccaaggaggatggctcgtgcaaagcttgcatagatggtgaaaactacaccagc
ggtcccaacgtcctgccttcctgcctttcctgcagggtctgtaaggaagataaagtcata
aaaagccgatgcgtcaaagctagaaacacagagtgtgagtgcaaaccaggcagctttgaa
gataaagactcgactgagatctgccagacatgctctaaaggctgtgaacaggaccatgaa
aacactgtgggtttatctctcttggacgcacagacatcgaggaagacaaatggctctcac
cacaacacggaacctgacagaactcagagttcgccattaggaaggaagttgctggtactg
gcaaatggaaacaacccagctgatgccctgaagttgatcttcgagcgctgttcgaccgaa
gtgccctttaactcctgggaccgtctcatgcggcatatgggtctcacagacaatcaaatt
caaatggtcagggctgagacacaagtcccatgtgaggtcttgtaccaaatgctgctgaag
tggctctaccaaacggggctaggcgcctctatcaaccacctgctaggtgccttggaagcg
gtgggagaaagatgtgccctggaggaaattgaagactatgctgtgaaatccgggaagttc
gtttatcagaacactacagcctag

DBGET integrated database retrieval system