KEGG   Rattus norvegicus (rat): 364430Help
Entry
364430            CDS       T01003                                 

Gene name
Nufip1
Definition
(RefSeq) NUFIP1, FMR1 interacting protein 1
  KO
K23308  nuclear fragile X mental retardation-interacting protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    364430 (Nufip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUFIP1 zf-C2H2_jaz zf-C2H2 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 364430
NCBI-ProteinID: NP_001007759
RGD: 1359440
Ensembl: ENSRNOG00000001033
UniProt: Q641W3
Position
15q11
AA seq 486 aa AA seqDB search
MAEPTPAGWPSAPELTPAPGTPSEAAPPQDNWVYWAMLPPPPPPLSSPVAGTEPCQKEQP
HVEPQPTSGAFPPFDAQILPAAQPPFDAQAPPDGQSQFNDQQAWNFQASTPWYWGLSPNG
FPTYNTSFHSPATHSYFPQSYANYNDFNLPQNRKQKKKKRKEPVFHFFCDTCDRGFKNQE
KYDIHMSEHKKCPEVDCSFSAHEKIVQFHWRNMHAPGMKKIKLDTPEDIARWREERRKNY
PTLANIERKKLLQLEKEKRGEVLTTTQYGKMKGMSRHSQMAKIRSPGKHYKWKSGGARQR
AVLGLGNRARDLKPEIPTKVNVDPLGVLIHSDSESDKDEKSQRAIVPKEVTPALCSLMSS
YGNVSGSESEPEEAPIKTEAEVLAENRVLPSSPPKSPRHNVRTTARTVLRAKWKAQRSGL
RKITLKQKKSPCHPLFEPRTRHPHLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLTAGS
VKTEDV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgactcctgccgggtggccttcagccccggaactgactcccgcgcccggg
actccgagcgaagcggcgccgcctcaggacaactgggtgtactgggccatgctgccgccg
ccaccacctcctctgtcgtccccggtggcggggacggagccgtgtcagaaggaacagccc
cacgtggagccccagcctacctccggagcgtttcccccgttcgatgctcagattcttccc
gcggcgcagcctccttttgatgcccaggcccctccagatggtcaatctcagttcaacgac
cagcaggcctggaatttccaagcctcgacgccttggtactggggattgtctcctaatggt
ttccccacatataacacgtccttccactctccggctacacattcttattttccacaatca
tatgcaaattacaatgacttcaatttgcctcaaaacagaaaacagaaaaagaagaaaaga
aaggaaccggttttccactttttctgtgatacctgtgatcgaggctttaaaaatcaagaa
aagtacgatatacacatgtctgaacataaaaaatgccctgaagtagattgctctttcagt
gcacatgagaagattgtccagtttcactggagaaatatgcacgctcctggtatgaagaag
atcaagctagatactccagaggatattgcaagatggagggaagaaagacgaaaaaactac
ccaactctggccaatattgaaaggaagaagctgttacagctggaaaaggaaaagagagga
gaagtgttgacaaccacacagtacggcaaaatgaagggcatgtccagacattcacagatg
gcaaagatcaggagtcctggtaaacattataaatggaaaagcggtggggctagacagaga
gcagtccttggactaggcaatcgtgccagagatttgaagcctgaaattccgaccaaggtt
aatgtagaccctcttggtgtattgatccacagcgactctgagtctgataaggatgagaaa
tcacaaagggctatagtgcccaaggaagtgacaccagccttgtgctcactgatgagcagc
tacggcaatgtctccgggtcagagagtgaaccagaagaagctcccatcaagacggaagca
gaagttctggcagaaaaccgtgttcttcctagcagtcctcccaagagtccaagacacaat
gttcgaacaaccgctagaactgtcttacgagccaagtggaaggcccagaggagtgggctc
cgaaagataacccttaagcagaaaaagagcccctgccacccattatttgaaccaagaaca
cgtcacccacatctcctggagatgcttctagctccagatattcgacatgagagaaatgtg
attctgcagtgtgttcgatatatcatcaaaaaagacttttttggacttactgctggttct
gtgaaaactgaagatgtgtag

DBGET integrated database retrieval system