KEGG   Rattus norvegicus (rat): 364529Help
Entry
364529            CDS       T01003                                 

Gene name
Calr3
Definition
(RefSeq) calreticulin 3
  KO
K10098  calreticulin 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    364529 (Calr3)
Lectins [BR:rno04091]
 Calnexin / calreticulin
  364529 (Calr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 364529
NCBI-ProteinID: NP_001012212
RGD: 1309243
Ensembl: ENSRNOG00000013260
UniProt: Q6AYG8
Position
16p14
AA seq 379 aa AA seqDB search
MVRARVSLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHK
EKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKIDCGGGYIKVFPSDLDQK
NLNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKSIRCKVDGFTHLYTLILRPDL
SYEVKVDGQSIESGSIEYDWNLTSLKKMEKTSLESRDWDEVEGNKAQDWEKHFLDAGPSK
PSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLE
LWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEDLL
MGKFHRHNHFSRFHRQGEL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggtccgggctcgcgtgtcgctctgggccatctgcgtgctgcgcgtggcactggccact
gtatacttccaggaggagtttctagacggagagcgctggaggaaccgctgggtgcagtcc
accaatgactcccagttcgggcacttccgagtctcatcggggaagttctatgggcataaa
gagaaagacaaaggcctgcagaccacccagaacagccgattctacgccatctctgcaagc
ttcaagccattcagcaacaaagggaagaccctggtaatccagtacacggtgaagcatgag
cagaagatcgactgtggcggtggctacatcaaggtcttcccgtctgacctggatcagaag
aatctgaatggaaagtcccaatactacatcatgtttggacctgatatctgtggatttgat
atcaagaaagttcatgttatcttatatttcaagaatcaatatcatgaaaataagaagtcg
atcagatgcaaggtggatggcttcacgcatctctacaccctgatcttaaggccagatctt
tcttatgaggtaaaagtcgatggccagtccatcgagtctggcagcattgagtatgactgg
aacctgacatcgctgaagaaaatggaaaaaacatcactggagtctagggactgggatgag
gtggaaggtaacaaagcccaggactgggaaaagcactttctggatgccggtcccagcaag
ccaagcgactggaacagtgagctggatggggactggctgcagaagccaccatacgaggat
ggcctgaaagctgagggcatcgacaaggacgtgtggctccaccagaagatgaggcccgct
ggctacctgacgcagtatgacctctcagagtttgagaacatcggcgccattggtctggag
ctgtggcaggtgagatctggaaccatctttgataacttcctgatcacagatgatgaagaa
tacgcagagaagtttggcaaggccacctggggggaaactaagggtccagaaaaggagatg
gatgccatacaggccaaggaagaagtaaaaaaagcccgagaggaagatgaggatctgctg
atggggaagtttcacaggcacaaccatttcagcagattccataggcagggcgaactgtag

DBGET integrated database retrieval system