KEGG   Rattus norvegicus (rat): 364594
Entry
364594            CDS       T01003                                 

Gene name
Tlr3
Definition
(RefSeq) toll-like receptor 3 precursor
  KO
K05401  toll-like receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    364594 (Tlr3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    364594 (Tlr3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    364594 (Tlr3)
   05160 Hepatitis C
    364594 (Tlr3)
   05171 Coronavirus disease - COVID-19
    364594 (Tlr3)
   05164 Influenza A
    364594 (Tlr3)
   05168 Herpes simplex virus 1 infection
    364594 (Tlr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    364594 (Tlr3)
   05165 Human papillomavirus infection
    364594 (Tlr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    364594 (Tlr3)
   04090 CD molecules [BR:rno04090]
    364594 (Tlr3)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   364594 (Tlr3)
CD molecules [BR:rno04090]
 Proteins
  364594 (Tlr3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD LRR_1 TIR TIR_2 LRR_9 LRR_6 LRRNT
Other DBs
NCBI-GeneID: 364594
NCBI-ProteinID: NP_942086
RGD: 735171
Ensembl: ENSRNOG00000021726
UniProt: Q7TNI8
Position
16
AA seq 905 aa
MKGRSSYLIYSFGGLLSLWILVVSSTNQCTVRYNVADCSHLKLTHIPDDLPSNITVLNLT
HNQLRGLPPANFTRYSQLALLDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTF
AFCTNLTELHLMSNSIRKIKSNPFKNQKSLIKLDLSRNGLSSTKLGTGVQLENLQELLLA
KNKIFALRSEELDFLGNSSLQKLDLSSNPLKEFSPGCFHAIGKLFVLLLNNAQLNLNLTE
KLCWELSNTSIQNLSLANNQLLATSNSTFSGLKQTNLTSLDLSYNSLRYVGNDAFSWLPH
LKYLSLEYNNIQSLTPHSFRGLSNLRYLSLKRAFTKQSVALASHPNIDDFSFQWLKCLEH
LNMDDNTIPGIKSNTFTGLVSLKYLSLSKTFTGLQTLTNETFVSLTHSPLLTLNLTKNHI
SKIASGTFSWLGQLRILDLGLNEIEQELTGQEWRGLGNIFEIYLSYNKYLQLTSKSFTLV
PSLQRLMLRRVALKSVDISPSPFRPLYNLTILDLSNNNIANLNEDLLEGLENLEILDFQH
NNLARLWKHANPGGPVNFLKGLSHLHILNLESNGLDEIPVKVFKNLFELKSINLGLNNLN
TLLPSIFDDQTSLRSLNLQKNLITSVEKSVFGPAFHNLNSLDMSFNPFDCTCESIAWFVT
WLNQTHTNIPELSTHYLCNTPQRYHGLPVKLFDTSSCKDSAPFQLLFIINTSTLLTFILA
VLLIHFEGWRISFYWNVSVHRILGFKEIDAQGEQFEYTAYIIHAQKDRDWVWEHFSPMEE
QDQSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFVITHHLLKDPLCRRFKVHHAVQQA
IEQNLDSIILIFLQNIPDYKLNHALCLRRGMFKSHCILNWPIQKERINAFHHKLQVALGS
RNSAH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgaaagggcgttcatcttatctaatatactcctttgggggacttttgtccctatggatt
cttgtggtgtcttccacaaaccaatgcactgtgagatacaacgtagctgactgcagccat
ttgaagctgacacacatacctgatgaccttccctctaatataacagtgttgaatcttact
cacaatcaactcagaggattaccacctgccaattttacgagatacagccaacttgctctc
ttggatgcaggattcaactccatttcaaaactggagccagaactgtgccaaattctccct
ttgttgaaggtattgaacctgcaacacaatgagctgtctcagatttctgatcaaaccttt
gccttctgcacgaacctgacagagctccatctaatgtccaactcaatacgcaaaattaaa
agcaaccctttcaaaaaccagaagagtctaatcaaactagatttgtctcgtaatggctta
tcatctacaaagttgggaactggagtccaactggagaacctccaagagctgctcttagct
aaaaataaaatttttgcactacgaagtgaagaacttgattttcttggcaattcttcctta
caaaaattggacttgtcatcaaatccacttaaagagttttctccagggtgtttccatgcg
attggcaagttattcgtcctcctcttgaacaatgcccaactgaacctcaacctcacagag
aagctttgttgggaactttcaaacacaagcatccagaatctctctctggctaacaaccag
ctgttagcaaccagcaacagcactttctccgggctgaagcagaccaacctcacctcgctt
gatctttcctacaacagcctccgatacgtcggtaacgatgccttctcttggctcccgcac
ctgaagtatctgtccctcgagtacaataatatacagagtttgacccctcactcttttcgt
ggactttccaacctgaggtacctgagtttgaagcgagcatttactaagcaaagtgttgca
cttgcttctcaccccaacattgacgatttttcctttcagtggctaaaatgtttggaacat
ctcaacatggacgataatactataccgggtataaaaagcaatactttcacaggattggtg
agtctgaagtacctaagtctttccaaaactttcacgggtttgcaaacgttaacaaacgaa
acgtttgtgtctcttactcattctcctttgctcactctcaatttaacgaagaatcacatc
tcgaagatagcaagtggtactttctcttggttgggtcaactcaggatacttgatcttggc
cttaatgaaattgagcaagaactcaccggccaggaatggagaggtctgggaaatatattt
gagatctacctgtcctataataaatacctccaactgactagcaagtccttcactttggtt
cccagccttcaacgactgatgctcaggagggtggcccttaaaagtgtggatatctcccct
tcgcctttccgtcccctttataacctgactattctggacttaagcaacaacaacattgcc
aacctgaacgaggacttgttggagggtcttgagaatctagaaattctggattttcagcac
aacaacttagcaagactctggaaacacgcaaacccaggtggtcccgttaatttcctgaag
ggtctgtctcacctccacatcttgaacttagaatccaatggcttagatgaaatcccggtc
aaggtgttcaagaacttattcgaactcaagagcatcaatctaggactgaataatttaaac
acgcttctaccatccatttttgatgaccagacatctctaaggtcactgaaccttcagaag
aacctcatcacatcagttgagaagagtgttttcgggccagcttttcacaacctgaacagc
ttagatatgagcttcaatccgttcgactgtacatgtgaaagcattgcctggtttgttacc
tggcttaaccagacccacactaatatccctgaactatccactcattacctctgcaatacc
ccccagcgttaccacggcctcccagtgaagctttttgacacatcatcctgtaaagacagt
gcccccttccaactcctattcataattaacaccagtacgctcctgacttttatacttgcg
gtactgctcattcacttcgagggttggaggatatctttttactggaatgtttcagtgcat
cgaattcttggtttcaaggaaatagatgcacagggtgagcagttcgaatacacggcatac
ataattcatgcccagaaagacagagactgggtctgggagcatttctccccaatggaagaa
caagaccaatctctcaaattttgcctagaagaaagggacttcgaagcaggggtccttgga
cttgaagcaattgttaacagcatcaaaagaagcagaaaaatcatctttgttataacgcat
cacctactgaaagacccgctgtgcagaagattcaaggtgcatcacgcggttcagcaagct
atcgagcaaaatctggattcaattatactgatttttctccagaatattccagattacaaa
ctaaaccatgcactctgcttgcgaagaggaatgtttaaatctcattgcatcttgaactgg
ccaattcaaaaagaacggataaacgcctttcatcataaactgcaagtagcacttgggtct
cggaattcagcacattaa

DBGET integrated database retrieval system