KEGG   Rattus norvegicus (rat): 364629Help
Entry
364629            CDS       T01003                                 

Gene name
Tpte2, Tpte
Definition
(RefSeq) transmembrane phosphoinositide 3-phosphatase and tensin homolog 2
  KO
K18079  PTEN homologous phosphatase
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    364629 (Tpte2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    364629 (Tpte2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Ion_trans DSPc PTPlike_phytase Y_phosphatase PKD_channel Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 364629
NCBI-ProteinID: NP_001102347
RGD: 1305825
Ensembl: ENSRNOG00000024837
UniProt: D4ADC8
Position
16q12.5
AA seq 673 aa AA seqDB search
MQGVKKSHLYLWMEHYGYDGPASSRVYSQLSRRRRNANKKVLSSTSKSTKLNGSIGYDGN
EETTTFTNGSSIDSMSYQDDMKSSNCMDPTSEKRYGNDSSLYTIDGTLNNGTTLYEMNSL
SELSKEVYLNDSALLRGKEAASELQVSSTMKTQSSVSTSILSTSDLISEEIQEEQINKCK
LNQISKLYDEDEHVDIRESYWSTVKKFVHFLVSSVAFRIFGILLIFLDVFLVAIDLHATE
KNIYIPLEYRAISLAIALFFLVDVLLRVYVEGRQRYFSDVLNTLDAVVIGVTVLVAVIYT
LYDKQFLRNIPRLAVLLRPLRLLILVRILQLAHQKRQLEKLTRQLVSGNKRRYKKDGFDL
DLTYVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERSYDPKRFHY
RVRRIMIDDHNVPTLEEMLLFSKEVNDWMAQDPENVVAIHCKGGKGRTGTMVCACLIASE
IVLNAKASLYFFGERRTDKSNSSKFQGVETPSQNRYVKYFEKLKTSYQLTLPPKKVLVIK
RFTVYSIHGVGKGNGSDLEIQIMMWQETIFSCFNSKNCMIFHDVETDKVIINVFNCPALY
DDVKVKFLCPNLPKYYDDCPFFFWFHTSFIRNNRLYLPRSELDNTHKQKTWKIYGPKFAV
EVYFEEISSTVMY
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagtcaaaaagagccatttgtatctctggatggagcactacggatacgatggg
cctgcaagttccagggtgtattctcagctctccagaagaagacgcaatgcaaacaaaaag
gtgttatcgagcacgtcgaagtccactaaactaaacggcagcattggctatgacggaaat
gaagagacaaccacgttcactaacggaagtagcattgacagtatgtcgtatcaagatgac
atgaaatcgtcaaattgcatggaccccaccagtgaaaaaagatatggaaatgattcgtca
ttatacaccattgacggaactttgaacaacggcacaaccctgtatgaaatgaattccttg
agtgaattatcgaaagaagtatacctgaacgattctgctttgctacgtggtaaagaagct
gccagcgaactccaagtctcaagtacaatgaaaacacaatcatctgtgtcgaccagcatt
ctcagcacatctgatttaatatcagaagaaatccaggaagagcaaatcaacaaatgcaag
ttaaaccagatctccaagctgtacgacgaggacgagcatgttgacatccgagagtcatac
tggagcacagttaagaaatttgtgcatttccttgtgtcctcagttgccttcagaatattt
ggaatactcctgatctttctggatgtatttcttgtggctatcgatctacatgccactgaa
aagaatatttatattcctttggaatatcgggccatttctttagctattgctttatttttc
cttgtggatgttcttctccgagtgtatgtagaagggagacagcgttatttctctgacgtg
ctgaacaccctagatgctgttgtcatcggcgtgactgtgctcgtggctgtcatttataca
ctttatgacaaacagtttctcagaaatattccaagactggcagtcttacttcggcctctg
cgactgctcatcctggtaagaattttgcagctggcccatcagaagcgacaactggaaaag
ctgactcggcagctggtttcgggtaacaagcgacgctacaagaaggatggcttcgacctg
gacctcacttacgtcactgagcgcattattgccatgtcatttccatcatctggaagggag
tccttctatagaaatccaattaaggaagttgtcaggttcctcgacaccaagcatccaaac
cactatcaagtctacaatctatgcagtgagagatcttatgaccctaagcgcttccactac
agggtccgcagaatcatgattgatgatcataacgtacctaccctcgaggaaatgttgttg
ttctccaaggaagtaaatgattggatggcccaagatcctgaaaatgttgtagcaattcac
tgtaagggaggaaaagggagaactggaaccatggtgtgtgcctgcctcattgccagtgaa
atagtcctaaacgcaaaggcaagtctgtacttttttggagagcgacggacagataaaagt
aacagctctaagtttcaaggagtagagaccccttctcagaatagatatgttaaatatttt
gaaaaactgaaaactagctaccaattgactcttcctccaaaaaaagtacttgtgataaaa
agattcactgtttactccattcatggtgttggaaaaggcaatggaagtgatctagaaata
caaataatgatgtggcaggagacgattttttcctgttttaattccaaaaattgtatgata
tttcatgatgttgaaacagacaaagtaataattaatgtgttcaactgtccggctctatat
gatgatgtaaaagtgaaatttctctgtccgaatcttcctaaatactatgatgactgcccc
tttttcttttggtttcatacatcttttattcgaaataacaggctttatctaccaagaagc
gaattggataatacccataaacaaaaaacatggaaaatttatggtccaaagtttgcagtc
gaggtgtattttgaggagataagctccacggttatgtactag

DBGET integrated database retrieval system