KEGG   Rattus norvegicus (rat): 364666Help
Entry
364666            CDS       T01003                                 

Gene name
Cdk20, Ccrk
Definition
(RefSeq) cyclin-dependent kinase 20
  KO
K08817  cell cycle related kinase [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    364666 (Cdk20)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     364666 (Cdk20)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   364666 (Cdk20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 364666
NCBI-ProteinID: NP_001020923
RGD: 1305219
Ensembl: ENSRNOG00000017991
UniProt: Q4KM34
Position
17p14
AA seq 346 aa AA seqDB search
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIED
SQYVVQLKAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHA
NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGGRLYTHQVATRWYRAPELLYGARQ
YDQGVDLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKI
SFKEQAPVPLEEVLPDASHQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSEL
PIPQRPGGPTPKAHPGPPHVHDFHVDRPLEESLLNPELIRPFIPEG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtattgcatcctcggtcgcatcggggagggcgcccacggcatcgtctttaaa
gccaagcacgtagagactggcgagatcgttgccctcaagaaggtggccctgcggcggctg
gaggatggtattcctaaccaggccctcagggaaatcaaggctctgcaggagatcgaggac
agtcaatatgtggtacagctgaaggctgtgttcccacatggtgcaggctttgtgctggct
ttcgagtttatgctgtcggacctggcggaggtggtgcgccatgcccagaggccactagcc
ccagcacaggttaagagctacctgcagatgctgctcaaaggtgttgcattttgccatgcc
aacaacatcgtgcatcgggacctgaagcctgccaacctgctcatcagtgcctcaggccag
ctcaagatagctgactttggactggcccgggtcttctctccagatggtggtcgcctctac
acacatcaggtggccaccaggtggtaccgagctcctgagctcctgtacggtgctcggcag
tatgaccagggtgttgacctatgggctgtaggctgtattatgggagagctgttgaatgga
tcccccctattcccgggagaaaacgacattgaacaactgtgctgtgtgcttcgaatcctg
ggtaccccgagtcctcgagtctggccggagatcacagagctgcctgactacaacaagatc
tccttcaaggagcaggcaccagtgcccctggaggaggtgctgcctgatgcctctcaccag
gccctggacctgctgggtcagttcctcctttaccctccacgacagcgtattgcagcctcc
caggcccttctgcatcagtatttcttcacagctcctctgcctgcccatccgtctgagctg
ccaattcctcagcgcccagggggacccacacccaaggctcatccagggcccccccatgtc
catgacttccatgtggatcgtcctcttgaggagtcactgttgaatccagaactgatccgg
cccttcatcccagagggctga

DBGET integrated database retrieval system