KEGG   Rattus norvegicus (rat): 364675Help
Entry
364675            CDS       T01003                                 

Gene name
B4galt7
Definition
(RefSeq) beta-1,4-galactosyltransferase 7
  KO
K00733  xylosylprotein 4-beta-galactosyltransferase [EC:2.4.1.133]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
rno01100  Metabolic pathways
Module
rno_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    364675 (B4galt7)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    364675 (B4galt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    364675 (B4galt7)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.133  xylosylprotein 4-beta-galactosyltransferase
     364675 (B4galt7)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   364675 (B4galt7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7C Glyco_transf_7N
Motif
Other DBs
NCBI-GeneID: 364675
NCBI-ProteinID: NP_001026831
RGD: 1309214
Ensembl: ENSRNOG00000021886
UniProt: Q4FZU7
Position
17p14
AA seq 327 aa AA seqDB search
MLPSRRKAAQLPWEDGRARLLPGGLRRKCSIFHLFIAFLLLVFFSLLWLQLSCSGDVAQV
TRGQGQETSGPPRACPPEPPPEHWEEDESWGPHRLAVLVPFRERFEELLVFVPHMHRFLS
RKKIQHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYQLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPLGITTGYQTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVRYRVDSRTAL
SVGGAPCTVLNVMLDCDKTATPWCTFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttgccctcccggaggaaagcggcgcagctgccctgggaggatggcagggccaggctg
cttcctggaggcctccgccggaaatgctccatcttccacctcttcattgcctttctcctg
ttggtcttcttctccctgctctggctgcagctcagctgttctggagatgtggcccaggtg
accaggggacaagggcaggagacctcgggtccaccccgagcttgtcccccagaaccgccc
cctgagcactgggaagaagatgagtcatgggggcctcaccggttggcagtgctggtgccc
tttcgggaacgctttgaggagctgctggtctttgtgccccacatgcaccgcttcctaagc
aggaagaagatccagcaccacatctatgtgctcaaccaggtggatcacttcaggttcaat
cgggcagcactcatcaatgtgggcttcctggagagcagcaacagcacagactacatcgcc
atgcacgatgtggacctactccctctcaatgaggagctggactatggcttcccggaggct
gggcccttccatgtggcttccccagagctccaccctctctaccactacaagacctatgtg
ggtggcattctgctgctgtccaaacagcactaccagctgtgcaacgggatgtccaaccgc
ttctggggctggggccgagaggacgatgaattctaccggcgcatcaaaggagctggtctc
cagcttttccgccccttggggatcacaactgggtaccagacatttcgccacttgcatgac
ccagcctggcggaagagggaccagaaacgcattgcggctcaaaaacaggaacagttcaag
gtggaccgggagggaggcctgaacactgtgaggtaccgggtggattcccgcacggcactg
tccgtaggaggggccccctgcactgttctcaatgtcatgctggactgcgataagacagcc
actccatggtgcacatttggctga

DBGET integrated database retrieval system