KEGG   Rattus norvegicus (rat): 364706Help
Entry
364706            CDS       T01003                                 

Gene name
Foxc1
Definition
(RefSeq) forkhead box C1
  KO
K09396  forkhead box protein C
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    364706 (Foxc1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    364706 (Foxc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 364706
NCBI-ProteinID: NP_599165
RGD: 1589718
Ensembl: ENSRNOG00000017800
UniProt: M0RCA0
Position
17p12
AA seq 553 aa AA seqDB search
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGM
ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ
GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV
KDKEEKGRLHLQEPPPPQAGRQPAPAPPEQAEGSAPGPQQPPVRIQDIKTENGTCPSPPQ
PLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAP
PPHHSQGFSVDNIMTSLRGSPQGSAAELGSGLLASAAASSRAGIAPPLALGAYSPGHSSL
YSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQG
PAGGGGSAAVDDPLPDYSLPPATSSSSSSLSHGGGGQETSHHPASHQGRLTSWYLNQAGG
DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPASQSLY
RTSGAFVYDCSKF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcgctactcggtgtccagccccaactccctgggagtggtgccctacctcggc
ggcgagcagagctactatcgcgctgccgcggcggcggccgggggcggctacaccgccatg
ccggcccctatgagcgtgtactcgcaccctgctcacgccgagcagtacccgggcggcatg
gcgcgcgcctacgggccttatacgccgcagccgcagcccaaggacatggtgaagcctccc
tacagctacatcgctcttatcaccatggctatccagaatgccccggacaagaagatcacc
ctgaatggcatctaccagttcatcatggaccgctttcccttctatcgggacaataagcag
ggctggcagaacagcatacggcacaacctctcgcttaatgagtgcttcgtcaaggtgccc
cgcgacgacaagaagccaggcaagggcagctactggacgctggacccggactcctacaac
atgttcgagaacggcagcttcctgcggcggcggcggcgcttcaagaagaaggacgcggtg
aaggacaaggaggagaagggccgactgcacctccaggaaccgccgccgccgcaggccggc
cgccagcccgcgcccgcgcccccggaacaggccgagggctccgctcccgggccacagcag
ccacccgtgcgcatccaggacatcaagacggagaacggtacgtgtccctcgccgccccag
cccctgtccccggctgccgccctaggcagcggcagtgcggccacagtgcctaaaatcgag
agtcccgacagcagcagcagcagcctgtcgagcgggagcagccccccgggcagcctgccc
tcggcgcggccgctcagcctggacgctgcagaacccgcgccgccgccacagcccgcgccg
ccgccgcatcacagccagggcttcagcgtggacaacatcatgacgtcgctgcgggggtcg
ccgcagggttcggctgcggagctcggctccggcctcctggcctcagccgctgcgtcctcg
cgcgcgggcatcgcgcccccgctggcgctgggcgcctactcgcctggccacagctccctc
tacagctccccctgcagccagagctccagtgcgggcagctcgggcggcggcggcggcggc
ggcggcggaggtggcggcagcagcagcgcagcgggtacggggggcgccgccacttaccac
tgcaacctgcaggccatgagcctgtacgcggcgggcgagcgtggcggccacttgcagggt
ccggccggaggcgggggcagcgcggcggtggacgaccccctgcccgattactcgctgccc
ccagcgaccagcagcagctcttcgtccctgagtcacggcgggggcggacaggagaccagc
caccaccctgcgtcccaccaaggccgactcacctcgtggtacctgaaccaggcaggtgga
gacctgggtcacttggcgagcgcagcggcggctgctgcggccgcgggctatcctggccag
cagcagaacttccactcggtgcgggaaatgttcgagtctcagcggatcggcttaaacaac
tctccggtgaatgggaatagtagctgtcagatggcttttcctgccagccagtctctgtac
cgcacgtcgggggctttcgtctatgactgtagcaaattctga

DBGET integrated database retrieval system