KEGG   Rattus norvegicus (rat): 364719
Entry
364719            CDS       T01003                                 

Gene name
Prss16
Definition
(RefSeq) protease, serine 16
  KO
K09649  thymus-specific serine protease [EC:3.4.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    364719 (Prss16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     364719 (Prss16)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S28
   364719 (Prss16)
SSDB
Motif
Pfam: Peptidase_S28 Peptidase_S37 Abhydrolase_1
Other DBs
NCBI-GeneID: 364719
NCBI-ProteinID: NP_001028882
RGD: 1306652
Ensembl: ENSRNOG00000057865
UniProt: Q3MHS0
Position
17p11
AA seq 512 aa
MAVKAPWLGFLLLVSLWGLSAPALLLRRLREHIQNFQESSNTHPGSVLGHGPGAIPKQGW
LEQPLDPFNATDRRIFLQRYWVNDQHRTGQDAPVFLHIGGEGSLGPGSVMTGHPAALAPA
WGALVISLEHRFYGLSMPAGGLDVALLHYLSSRHALADVASARQALSGLLNVSSSSPWIC
FGGSYAGSLATWTRLKFPHLVFAAVASSAPLNAVVDFSAYNQVVARSLTQVTIGGSLECL
AAASTAFAEVERLLRAGLASQAVLREELGACGSLDLIEDQAELLGALQALVGGTVQYDGQ
AGSPLSVRQLCGLLLRTWGNRNHSTPYLGLRRAVQRVLRSMGQKCLSSSRAETVAQLRNT
EPQVSGVGDRQWLYQTCTEFGFYVTCEGLQCPFSQLPALPFQLDLCEQVFGLSPSSVAQA
VAQTNSYYGGQSPGATQVMFVNGDTDPWHVLSVTQDLGPSEPALLIPSASHCLDMAPMRP
SDSPSLRLGRQKIFQQLQVWLKDIRRARTDEI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcagtcaaggctccatggttgggcttcttgcttctggtttccctctggggactgtca
gctccagctttgcttctccggcgcctgagagaacacattcagaactttcaggagagctct
aacacacacccaggctctgtcctaggccacggtcctggagctatccccaaacaagggtgg
ttagaacagccactggatcccttcaatgcaactgacagacgaatcttcctacagcggtac
tgggtgaatgatcaacacagaactggccaagatgcaccagtatttctgcacataggaggt
gagggcagccttggacctggctcagtaatgacagggcatcctgctgcactggcccctgcc
tggggggccctggtgataagcctggaacacagattctatggtctgagtatgcctgctggg
ggcctggatgtggccctgctccactacttgtccagccgccatgcgttggctgacgtggcc
tctgctcgtcaggcgctctccggcctcctcaatgtgtcttcctccagcccttggatctgc
ttcggaggctcctatgctggctcgctggcgacctggacccggttgaagttcccccaccta
gtctttgccgccgtcgcctcctccgcaccattgaacgcagtagtggacttctccgcctat
aaccaggtggtggccagaagcctgacgcaagtcaccataggcggatcattggagtgcctg
gcggcggcctccacagcctttgcggaggtagagcggctgctgcgcgcaggtctggcgtct
caggctgtgctgagggaggaactgggcgcctgcgggtccctggaccttattgaagaccaa
gcggagctgctgggagcgttgcaggcactggtgggaggcacggtgcagtacgacgggcag
gcgggatcgccgctaagcgtgcgccagctctgcggactcctgctccggacctggggaaac
cgcaaccactccacgccttacctggggcttcgccgggctgtacagagagtcttgcgcagc
atgggacagaagtgtttaagctcttccagagcagagacagtggcacagctgagaaacacc
gaaccgcaagtgtctggcgtgggggaccggcagtggttgtatcagacatgcactgagttt
ggcttctatgtcacctgtgagggccttcagtgtcctttttcccagctcccagcactgccc
ttccagctagatctgtgtgaacaagtgtttggcctctcaccttcatctgttgcccaggct
gtggcccagacaaactcctattatggtggccaaagtcctggagccacccaagtaatgttt
gttaacggggacacagatccctggcatgtactgagtgtaacacaggacttaggaccctct
gagccagcccttctaattcctagtgcctcccactgccttgatatggcacctatgaggcct
tcagactctcctagcctccgcctagggcgtcagaaaatcttccagcaattacaggtctgg
ctcaaagatataagaagagccaggactgatgagatctga

DBGET integrated database retrieval system