KEGG   Rattus norvegicus (rat): 364754
Entry
364754            CDS       T01003                                 

Gene name
Fzd8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    364754 (Fzd8)
   04390 Hippo signaling pathway
    364754 (Fzd8)
   04150 mTOR signaling pathway
    364754 (Fzd8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    364754 (Fzd8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    364754 (Fzd8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    364754 (Fzd8)
   05205 Proteoglycans in cancer
    364754 (Fzd8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    364754 (Fzd8)
   05226 Gastric cancer
    364754 (Fzd8)
   05217 Basal cell carcinoma
    364754 (Fzd8)
   05224 Breast cancer
    364754 (Fzd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    364754 (Fzd8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    364754 (Fzd8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    364754 (Fzd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    364754 (Fzd8)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  364754 (Fzd8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 364754
NCBI-ProteinID: NP_001037716
RGD: 1560525
Ensembl: ENSRNOG00000061031
UniProt: Q498S8
Position
17q12.1
AA seq 684 aa
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPQPGEQPPSGS
GHSRPPGARPPHRGGSSRGSGDTAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSE
RHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDME
RFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAATAGAGAA
GAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFL
AAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRG
FVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVP
AAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVW
VWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGGGPGPGGGGGHGGGGGSLYSDVS
TGLTWRSGTASSVSYPKQMPLSQV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctactagccgccttggcggtgctacag
cgctcgagcggcgctgccgcggcttcggccaaggagctggcgtgccaagagatcacagtg
ccgctgtgcaagggcatcggttacaactacacctacatgcccaaccagttcaaccacgac
acgcaagatgaggcgggcctagaggtacaccagttctggccgctggtggagatccagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaaacctctgccgccttgccgctctgtgtgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcctggcctgaccgaatgcgctgcgatcggctgccggag
cagggcaaccccgacactctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgccgccgccgcagcctggcgagcagccgccctccggcagc
ggccacagccgcccgccaggggccaggcccccacatcgtggcggcagcagtaggggcagc
ggggacacggcggctgcgcccccctctcgcggcgggaaggcgaggccccctggtggcggc
gccgctccctgcgagcccgggtgccagtgccgcgcgcccatggtgagtgtgtccagcgaa
cgccacccgctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccctgc
cacaaccccttctttagccaggatgagcgcgccttcactgtcttctggatcggcttgtgg
tcggtgctctgcttcgtctccaccttcgccactgtctctaccttcctcatcgatatggag
cgctttaagtacccggaacggcccattatattcctctctgcctgctacctcttcgtgtct
gtcgggtacctggtgcgcctggtggctggacacgagaaagtggcctgcagcggcggcgcg
ccgggtgcaggaggagctgggggtgctggcggcgcggcgaccgctggcgcgggggcggcg
ggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagctgggtgcagtggag
cagcacgtgcgctatgagaccactggccccgcgctgtgcacggtagtcttcctccttgtc
tacttttttggcatggctagctccatctggtgggtaatcctgtctctcacgtggttcttg
gcggctggtatgaaatggggcaacgaggccatagcaggctactcgcaatacttccacctt
gccgcgtggctcgtgcccagcgtcaagtccatagcggtgctggcgctcagctccgtggac
ggcgacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgcggc
tttgtactggcgccactggtcatctacctcttcattgggactatgtttctgttagctggc
ttcgtgtcgctgttccgaatccgctcagtcatcaagcaacaaggaggcccaaccaagact
cacaagctagaaaagctcatgatccgcttgggcctcttcaccgtgctctacacggtgccc
gccgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccgcgctgggaggcc
acgcacaactgcccatgccttcgcgacctgcagccagaccaggctcgcaggcccgactac
gcggtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacatcaggcgtgtgg
gtctggtccggcaagactctggagtcctggcgtgcgttgtgtactcgctgctgctgggcc
agcaagggcgctgcagttggcgcgggcgccggaggcagcggccctgggggcggtggcccc
gggcccggtgggggtggggggcacggcggaggtgggggatccctctacagcgacgtcagc
accggcctgacgtggcggtctggcacggccagctctgtatcttaccctaagcaaatgcca
ttgtcccaagtctga

DBGET integrated database retrieval system