KEGG   Rattus norvegicus (rat): 364773
Entry
364773            CDS       T01003                                 

Gene name
Akr1c13, TBER1
Definition
(RefSeq) aldo-keto reductase family 1, member C13
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 364773
NCBI-ProteinID: NP_001014262
RGD: 1359406
Ensembl: ENSRNOG00000033010
UniProt: Q5I0M4
Position
17q12.2
AA seq 323 aa
MSSKLHCVKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEE
IGQAIQSKIKAGVVKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPV
PIKSSVDESPLDEKGKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKP
GLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPI
LCDVAKKNKRSPALIALRYLFQRGVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLN
KNFRYLSAEFLADHPEYPFSEEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagctccaaactgcactgtgtcaaactaaacgatggccacttcattcctgccctgggc
tttggcacctataaacccaaggaggttcccaagagtaagtcacttgaggcggcacaccta
gctatagatgttgggtaccgccacattgatacggcctctgcataccaagtagaagaggag
ataggacaggccattcaaagcaagattaaagctggtgttgtaaagagaaaagacatgttc
atcactacaaagctttggtgcagttgctttcgaacagagatggtcagacctgctttggaa
aaatcactgaaaaaccttcaactggattatgttgatcttttccttatacattacccagtg
ccaataaagtcaagtgttgatgaatctccattagatgaaaaagggaaatttctattggat
actgtggatttctgtgacacatgggagatgttggagaagtgtaaggatgcagggttggtc
aagtccattggtgtgtccaactttaaccacaagcagctggagcgactcctaaacaagcca
ggactgaagtacaaacctgtctgcaaccaggttgaatgtcatctttatttgaaccagagt
aagctactggattactgcaaatcaaaagacattgttctcgttgcctatggtgctctggga
acccagcgatataaagaatgggtggaccagaactcccccgttctcttggatgatccaatt
ctctgtgatgtggctaaaaagaacaagcgaagccctgccttgattgcccttcggtacctg
tttcagcgtggggtggtgccccttgcccagagtttcaaagagaatgagatgagagagaat
ttgcaggtttttgaatttcagttgtctcctgaggacatgaaaacactagatggcctgaac
aaaaattttcgatatctttcagcagagtttcttgctgaccacccagaatatccattttca
gaggaatattaa

DBGET integrated database retrieval system