KEGG   Rattus norvegicus (rat): 364786
Entry
364786            CDS       T01003                                 

Gene name
Itga8, RGD1564327
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  integrin alpha 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    364786 (Itga8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    364786 (Itga8)
   04514 Cell adhesion molecules
    364786 (Itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    364786 (Itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    364786 (Itga8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    364786 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    364786 (Itga8)
   05414 Dilated cardiomyopathy
    364786 (Itga8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    364786 (Itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    364786 (Itga8)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   364786 (Itga8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha Pilin_GH LYRIC
Other DBs
NCBI-GeneID: 364786
NCBI-ProteinID: NP_001167443
RGD: 621634
Ensembl: ENSRNOG00000016538
UniProt: B5DEG1
Position
17q12.3
AA seq 1062 aa
MSARTHRGPPENWAPPFACLCCVSAVLGMLWSPVSLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNVDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSVADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSLQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQVSALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNARGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGEGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSLRVCASIAGQSISNTVALMAE
VQLDFLKQKGAIKRTLFLHNHQSHLIFPFVMRQQKSLHCQDFMVYLRDETEFRDKLSPIN
VSLNYSLDDSTFEDGLEVKPILNHYRENVVTEQAHILVDCGEDNLCVPDLRLSARPDKQE
IIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGLRLLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSVQINV
TAVAQVEIRGVSHPPQIVLPIHNWEPAEEPHKEEEVGPLVEHIYELHNIGPSTISDSILE
VGWPFSAREEFLLYVFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQPHRQSPAKILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLQR
KNDPYALASLVSFEVKKIPYKEQPAKLPAGSTAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgcgagaacccaccggggtcccccggagaactgggcacctccgttcgcttgtctc
tgttgcgtctcggccgtgctggggatgctgtggtcccccgtgtctctggcgttcaacttg
gacgtagacaagctcacggtgtacagtggccccgagggcagctacttcggctactcgctg
gacttctacatacctgatgcgcgcacagccagtgtcttggtgggggcgcccaaagccaac
actagccagccggatatcgtagaagggggagctgtctactactgtccctggcctgcagag
aggtctgcacagtgcaagcagataccctttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagagcctatagaatttaaatcaaaccaatggtttggagccacagtgaga
gctcacaaaggaaaagttgtggcttgtgcccctttatatcactggagaactctgaagcct
aatccagcaaaggacccggttggcacatgctatgtagcaattcagaacttcagtgcttac
gctgagcactcaccctgtcggaacagcaacgttgatcctgaaggccaaggttactgccaa
gccggcttcagtctagacttctataagaatggagaccttatagtgggaggacctggaagc
ttttactggcaaggtcaggtgatcacggtcagtgtagcagacatcattgcaaattactca
ttcaaagacattcttcgaaaactggcagcagaaaagcagacagatgtggctccagcttcc
tatgatgacagctaccttggatattcagttgctgctggagaattcactggggactctctg
caagaattggttgctggaattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagatatgaccttcattcagaattttactggtgagcagatggcatcttatttc
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggtcggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggtcaggtctac
ctgtacctacaagtgagcgccctcctcttccaagacccacaggtccttacgggcacagag
acttttgggagattcggtagttctgtggcccacttgggggacctgaaccaagatggatac
aatgatattgccatcggtgtgccctttgcaggcaaggatcaaagaggtaaagtcctcatt
tacaacggaaacgccagaggcttgcacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggattcggcttttctctaagaggagacgcagacatagac
aagaatgattacccagatttacttgtcggggcatttggagaagggaaagtggccgtgtac
agagcaaggccagttgtaacagtggatgcccagcttctgctgcacccaatgattatcaac
cttgaaaataaaacttgccagattccagaattcccgactcctgtggcctgcttttcttta
agagtctgtgcatctatagcaggccagagcatttcaaatacagtagccctgatggccgag
gtgcagttagatttcctgaagcaaaaaggagccatcaaacggaccctcttcctccacaac
caccagtcccacctcatcttccccttcgtgatgaggcagcaaaaatccctccactgccag
gattttatggtttaccttcgagatgaaactgaattccgagataaactgtctccaatcaac
gttagcctgaactacagtttggatgattccacctttgaagatggcctggaagtgaagccg
attttgaaccactacagggagaatgtcgttactgagcaggctcacatcctggtggactgt
ggagaagacaacctctgtgttcctgacttgaggctgtcagctagaccagataagcaggag
ataattattggggatgaaaatcacctaatgctcataatcaatgcaaggaatgaaggagaa
ggagcttacgaagctgaactcttcgtcatgattcccgaagaagcagattacgttgggatc
gagcgcaacaacaagggactgaggctcctgagttgtgagtacaagatggaaaacgtaacc
aggatggtggtgtgtgaccttgggaacccgatggtgactggaacgaatttttctctgggc
ctccgatttgctgttcctcgtcttgagaaaacaaacatgagtattaacttcgatctccaa
atcagaagctccaacaaggacaatcctgacagcaatttcgtgagcgtgcaaatcaacgtc
actgccgtggctcaggtggaaatcagaggagtgtcccaccctccccaaattgttctgccc
atccacaactgggagccagcagaggagccccacaaagaggaggaagtcggtcccctggtt
gaacatatttatgagctgcacaatattggacccagcaccatcagtgacagcattctcgaa
gtgggctggccattctctgcacgggaggagttcctcctctatgtctttcatcttcaaact
ctgggacctctacaatgtcaaacaaatcctgagatcaacccgcaggatataaagcctgct
gcctccccagaggatacccctgagctcagcgccttcttaagaaatgctacaattccccat
cttgtcaggaagagggatgtgccagtggtccagccccacagacagagcccggcaaaaata
ctgaactgtaccaacattgactgcttgcaaatctcgtgtgcagtgggtcgcctgggagga
ggagaaagtgcagttctgaaggtcagatcgagattgtgggcgcacacattcctccagaga
aagaacgacccttatgctcttgcatccctggtgtcctttgaagtcaagaagataccttat
aaagagcagccagcaaaactgccagccgggagcacagcgattaagacatcggttatttgg
gccactccaaatgtctccttctcaattccactgtgggtcataatactagcgatccttctt
ggcttgctggttctggccatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggatgaaatgacagacagggaacaactgaccagtgacaagaccccg
gaggcttga

DBGET integrated database retrieval system