KEGG   Rattus norvegicus (rat): 364834
Entry
364834            CDS       T01003                                 

Gene name
Polr2d
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB4
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    364834 (Polr2d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    364834 (Polr2d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    364834 (Polr2d)
   03400 DNA repair and recombination proteins [BR:rno03400]
    364834 (Polr2d)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     364834 (Polr2d)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      364834 (Polr2d)
SSDB
Motif
Pfam: RNA_pol_Rpb4 Maelstrom Tfb4
Other DBs
NCBI-GeneID: 364834
NCBI-ProteinID: NP_001102356
RGD: 1308565
Ensembl: ENSRNOG00000016231
UniProt: D4A259
Position
18
AA seq 142 aa
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggcaggtggaagcgatcctcgagctggcgacgtagaagaagatgcttcccagctc
atctttcccaaagagttcgaaacagctgagacgctcctgaactctgaagttcacatgctt
ctggagcaccgaaagcagcagaatgagagtgcggaggacgaacaggagctttcagaggtt
ttcatgaaaaccctgaactatacagcccgtttcagccggttcaaaaacagagagaccatt
gccagtgttcgtagcctgcttctccagaagaagttacataagtttgaattggcttgttta
gccaatctgtgcccggagactgctgaggagtccaaagcgctgattccaagcctggaaggg
cgttttgaagatgaggaactgcagcagattcttgatgatatccagacgaagcgcagcttc
cagtactga

DBGET integrated database retrieval system