KEGG   Rattus norvegicus (rat): 364844Help
Entry
364844            CDS       T01003                                 

Gene name
Pcdhgb7
Definition
(RefSeq) protocadherin gamma subfamily B, 7
  KO
K16496  protocadherin gamma subfamily B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    364844 (Pcdhgb7)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Protocadherins
   364844 (Pcdhgb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 364844
NCBI-ProteinID: NP_001012215
RGD: 1588516
UniProt: Q5PQQ0
Position
18p11
AA seq 931 aa AA seqDB search
MGGSSARRQRPGRPQVLFTLLLPLFCPALGQPVRYSIPEELDRGSVVGNLAKDLGLSVLE
VSARKLRVSAEKMHFSVDSESGDLLVKDRIDREQICKGRRRCELQLEAVLENPLNIFHVV
VEIEDVNDHAPQFPKDEINLEISESVSPGVRTILESAKDPDIGMNSLSKYQLSPNDYFLL
LVKDNPDGTKYPELELQKMLDRETESTHNLVLTAVDGGDPPRSGTAQLRIRVMDANDNPP
VFSQEVYRVRVREDLPPGTTVLRLRATDQDEGINAEFTYSFLGVANKAQHEFSLDPVTGD
IITLQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDENDNRPEIIITSLSDQILEDS
PSGTVVALFKVRDRDSGENAEVTCSLSGNNPFKIHSSSNNYYKLVTDSILDREQTPGYNV
TITATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLINVPENNQPGTSITQVRAWDPD
VGSNGLVSYSIIASDLEPKVLSSFVSVNQDSGVVFAQRAFDHEQLRSFQLTLQARDQGSP
ALSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGH
NAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDKDAARQRLLVAVRDGGQPPLSATATL
LLVFADTLQEALPDLVDHPIPPDPQSELQFYLVVALALISVLFLLAIILAIALRLRQSSS
PSTTGCFGSVLGSKSRPVLPPNSSEGTLPYAYNVCVPGDQLKPEFNFLTSVGDYPAAQDL
LNKDSSSALLASILTPGVEADEQTFNQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNN
QFDTEMLQAMILASASEAADGSSTLGGGTGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN
ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgggagggagcagcgcgcggaggcagcgccccggccgcccgcaggtactgtttaccctg
ctgctgcctttgttctgtcccgcgctgggccagcccgtccgctactccatccctgaggag
ctggaccgaggttcggtggtggggaacctcgctaaggatctggggctcagtgtcctggaa
gtgtcggctaggaagctgcgggttagcgctgagaagatgcacttcagcgtggattccgag
agcggggacttactggtgaaggaccgcatagaccgcgagcagatatgcaaagggaggaga
aggtgtgagctacagttggaagccgtgctggaaaaccctttaaacatttttcatgtggtt
gtggagattgaagatgttaatgatcacgctcctcaatttccaaaagacgaaataaaccta
gagataagtgaatccgtcagcccaggtgtgagaacaattctggagtcagcaaaagatcct
gatattggtatgaattctctaagtaaatatcagttaagtcctaacgactacttcttattg
ttggtgaaagacaatccggatggtaccaaatacccagaattagaattgcagaagatgctg
gaccgagaaacagagagcacacacaacctggtgctgacagctgtagacggtggggacccg
ccccgaagtggcacagctcagcttcgaatccgagtgatggacgccaatgataaccctcca
gtgttcagccaagaagtgtacagagtccgcgttcgagaagacttgcctccagggaccacc
gtcctaaggctgagggccacggatcaggacgagggcatcaatgcagagttcacatattcc
ttcctgggtgtggctaacaaagcccagcacgagttctctctggatcccgtaacaggagat
ataataactctacagtcgttagactttgaagaagtagaacaatatacgattgatgtggag
gcgaaggatcgaggatctctttcttcgcagtgtaaagtaattatagaagttctggatgag
aacgacaaccgcccagaaataatcatcacttctctctcggatcagattttggaggattcc
ccttccggaacggttgtggccctcttcaaggtacgggatcgagattctggggaaaacgca
gaagtcacttgcagtttaagcggaaacaacccatttaagattcattcttcttccaataat
tactacaagttagtaacagatagcatcctagatcgagaacagacaccagggtacaacgtc
actatcacagccacagataggggcaagccgcccctttcctccagcacaaccatcactctg
aatgtcgctgatgtcaacgacaatgcgccagttttccaacagcaggcctacctaataaac
gtaccagaaaacaaccagcccggtacgtccataactcaagtcagagcatgggatccagat
gtgggatccaatggcctcgtctcctactccatcatagctagcgacctagaaccaaaagtg
ctgtcatccttcgtgtctgtgaaccaggacagtggggtggtgttcgcgcagcgcgccttc
gaccacgagcagctgcgctccttccagctgactctacaggcgcgagaccagggatcgcct
gcgctcagcgccaacgtgagcatgcgcgtgctggtgggcgaccgcaatgacaacgcgcca
cgcgtgctgtatcccgctctcgagccggacggctctgcgctcttcgatatggtgccgcgc
gctgccgagcccggatacttggtcacgaaggtggtggctgtggatgccgactcgggacac
aatgcctggctgtcttaccacgtgttgcaggccagtgatcccgggctcttcagcctgggg
ctgcgcacaggcgaggtgcgcacagcgcgtgccttgggcgataaggatgcagctcgtcag
cgccttctggtcgctgtgcgtgatggtggacagccacccctgtccgctactgctacactg
cttctagtttttgcagacaccctacaagaagcgttgccagacctcgtcgatcatcccatc
ccccccgaccctcagagtgagcttcagttttacctggtggtggccttggccctgatctcg
gtgcttttccttctcgcaataattttggccattgctttgcgcctgcgacagtcttccagc
ccatcaaccactggttgctttgggtcggttcttggttccaagtctagaccagtacttcca
cccaactccagtgaggggacattgccctatgcctataatgtgtgcgtgccaggagatcaa
cttaagccagaatttaattttctcacatccgttggagattatcctgccgcacaagatctt
ctcaacaaagatagctcctcggcactgctggctagcattttaactcctggcgtggaagca
gacgagcagacctttaaccagcaagccccgcccaacactgactggcgtttctctcaagcc
cagagacccggcacgagcggatcccaaaatggggatgaaaccggcacctggcccaacaac
cagttcgatacagagatgctgcaagccatgatcttggcctctgccagtgaagccgctgat
gggagctccactctgggagggggcactggcactatgggtttgagcgctcgatatggaccc
cagtttaccctgcagcacgtgcctgactaccgccagaacgtgtacatccctggcagcaat
gccacactgaccaacgcagctggcaaacgagatggcaaggctccggcaggcggcaatggc
aacaagaagaagtcgggcaagaaagagaagaagtaa

DBGET integrated database retrieval system