KEGG   Rattus norvegicus (rat): 364867
Entry
364867            CDS       T01003                                 

Gene name
Ticam2
Definition
(RefSeq) TIR domain-containing adapter molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno05133  Pertussis
rno05161  Hepatitis B
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    364867 (Ticam2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    364867 (Ticam2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    364867 (Ticam2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    364867 (Ticam2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    364867 (Ticam2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    364867 (Ticam2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    364867 (Ticam2)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 364867
NCBI-ProteinID: NP_001102360
RGD: 1308258
Ensembl: ENSRNOG00000042070
UniProt: D3ZXR7
Position
18
AA seq 232 aa
MGVGKSKLDKCPLSWHKRDSVDGDQGCHESDSKNSENASSPAFVVHSNGVEQPIGEQDRP
EAKGEGHEEQAEEEFLKFVILHAEDDTNEALRVQNLLQNDFGIRPGIVFAEMPCGRLHLQ
NLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNSPLPRE
RTPLALQTINALEEESQGFSTQVERIFRESVYERQQSVWKETRSVTQRQFIA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgggtgttgggaagtctaaactagataagtgccctctttcttggcataaaagagacagt
gtggatggcgatcaaggctgccatgagtcagactccaagaactctgagaatgcgtcctcg
cctgcttttgtggtgcatagcaatggagtagaacagccaataggggagcaggacagaccc
gaggcaaagggggaggggcatgaggagcaagctgaagaagagttcctcaaatttgtgata
ctgcacgcagaagatgacaccaacgaggccctccgagtccagaatctactgcaaaacgac
tttggtatcaggcctgggatagtcttcgccgagatgccatgcggaagactgcacttgcag
aatctagacgatgcggtaaatgggtccgcctggacgatcttgttactgactgagaacttc
ttaagagacacctggtgcaacttccagttctacacttccctgatgaattctgtgaacagg
caacacaagtacaattccgtcatacctatgcggcccctgaacagtcctcttcccagggaa
aggactccgttggcgctgcaaaccatcaatgccttagaggaagaaagccaaggcttttcc
acacaagtggagaggattttccgggaatctgtgtatgagaggcaacaaagtgtatggaag
gagacacgaagtgtgacacagagacagttcattgcctga

DBGET integrated database retrieval system