KEGG   Rattus norvegicus (rat): 364900
Entry
364900            CDS       T01003                                 

Gene name
Ctif, Gm672
Definition
(RefSeq) cap binding complex dependent translation initiation factor
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MIF4G DUF5688 Sec34 Goodbye
Other DBs
NCBI-GeneID: 364900
NCBI-ProteinID: NP_001102361
RGD: 1311887
Ensembl: ENSRNOG00000018342
UniProt: D3ZD47
Position
18q12.2
AA seq 336 aa
MKHPPGDKGEAGSHRNAKETVTVENPKLEDGPGDTGHSGLEPPCSPDTLTPTASERPTPQ
LPGGSEAETKQKDTALPERLGERPKITLLQSSKDRLRRRLKEKVPDEVAVEASNPQPNKM
DRLTEILNSMRNNSSDVDAKLTSFMEEAQNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAA
KLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSST
GEPFRVLLLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSESML
TRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaagcatccgccaggagacaagggagaagcgggcagccaccgcaacgccaaagagacc
gtgaccgttgagaaccccaaacttgaagacggcccaggggacaccggacacagtggcctt
gagcccccctgcagccctgacactctgaccccaacagcttccgagaggccaacccctcag
ctgccagggggttcagaggctgagacaaagcaaaaagacactgctcttcccgagcgtctt
ggggagcggcccaaaatcaccctgctccagtcttccaaagacaggctgaggcgaaggctg
aaagaaaaggtaccggacgaagtagcagtagaggccagcaaccctcagccaaacaagatg
gacaggctgacggagatcctgaacagcatgaggaataacagcagtgacgtggacgccaag
ctcacctccttcatggaggaagcgcagaactccaccaactccgaggagatgctgggagag
atcgtgcggaccatctaccagaaggccgtgtcagaccgcagcttcgccttcacggccgcc
aagctctgcgacaagatggccctcttcatggtcgaggggaccaagttccggagcctgctc
ctcaacatgctccagaaggacttcactgtgcgtgaggagctacagcaacaggatgtggag
cgctggctgggcttcatcaccttcctgtgtgaggtgtttggcaccatgcggagcagcact
ggcgagcccttccgagtgctgctcttgcagtctcaggatgtgaaggaagacgctgtcctc
tgctgctccatggagctgcaaagcacaggccggctactagaggagcagctgccggagatg
atgacggagctcctagccagcgcgcgagataagatgctgtgcccctcagagtccatgcta
acacgctccctgctcctggaggtcatcgagctccacgccaatagctggaaccctctgacg
ccccccatcacgcagtactacaacaggaccatccagaaactgacagcctga

DBGET integrated database retrieval system