KEGG   Rattus norvegicus (rat): 364901
Entry
364901            CDS       T01003                                 

Gene name
St8sia5
Definition
(RefSeq) alpha-2,8-sialyltransferase 8E
  KO
K03369  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8E) [EC:2.4.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Module
rno_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    364901 (St8sia5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    364901 (St8sia5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     364901 (St8sia5)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   364901 (St8sia5)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 364901
NCBI-ProteinID: NP_998793
RGD: 1302934
Ensembl: ENSRNOG00000022691
UniProt: Q6ZXC8
Position
18
AA seq 376 aa
MRYADPSANRDLLGNRTLLFIFICAFALVTLLQQILYSKSYIKRYFEFYKEPLEFNSTRC
LELRQEILEVKVLSMVKQSELFERWKSLQICKWAMDASEASLFKSTLSRCCNAPNFLFTT
QKNTPVETNLRYEVESSGLYHIDQEIFKMFPKEMPYYRSQFKKCAVVGNGGILKNSGCGK
EINSADFVFRCNLPPISGIYTTDVGEKTDVVTVNPSIIIDRFHKLEKWRRPFFSVLQRYE
NASVLLPAFYNVRNTLVSFRVKYMLDDFQSGEPVYFFHPHYLSSVSRYWLSLGVRARRIS
TGLILVTAALELCEEVHLFGFWAFPMNPSGFFITHHYYDNVKPKPGFHAMPSEIFTFLRM
HSRGILRVHTGTCNCC
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcgctacgcagacccctcggccaacagggatttgttggggaaccgaactttgctcttc
atcttcatctgcgccttcgccttggtgaccttgctccagcagatcctgtacagcaagagc
tacatcaagaggtacttcgaattttacaaggaacctttagaatttaactccacgagatgc
ctggagctgaggcaggagatcctggaggtgaaggtgctgtccatggtgaagcagtctgaa
ctgttcgaaaggtggaagagcctccagatatgcaaatgggcgatggacgcctcggaagcc
agcctcttcaagtccaccttgtccaggtgttgcaatgcccccaactttctcttcaccacc
cagaagaacaccccggttgagacgaatctcaggtatgaggtggagtccagtggcttgtat
cacatcgaccaagagatcttcaaaatgtttcccaaggaaatgccctactaccgctctcag
tttaagaagtgtgctgtggtgggcaatggcggcatcttgaagaacagcggctgcgggaag
gagatcaacagcgctgacttcgtcttccggtgcaatctgccccctatctcagggatatat
accacagatgtgggagagaagacagatgtggtcaccgtgaatcccagcatcataattgac
aggttccacaagttggagaagtggcggcggcccttcttcagcgtgctgcagaggtacgag
aacgcctcggtgctgctgccggccttctacaatgtgcgcaacaccctcgtgtccttccga
gtcaagtacatgctggacgacttccagtcgggggagcccgtctacttcttccatcctcat
tacctgagcagcgtgtcgcgctactggctcagcctgggcgtgcgcgcacggcgcatcagc
accggcctcatcctggtcactgcggccctggagctctgcgaggaggtgcacctgttcggt
ttctgggccttccccatgaacccctccggcttcttcatcacgcaccactactatgacaat
gtcaagcccaagcccggctttcatgctatgccctcggagatcttcaccttcctgcgcatg
cacagccgcggcatcctccgcgtgcacacaggcacctgcaattgctgctga

DBGET integrated database retrieval system