KEGG   Rattus norvegicus (rat): 364948
Entry
364948            CDS       T01003                                 

Gene name
Asphd2, RGD1306020
Definition
(RefSeq) aspartate beta-hydroxylase domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Asp_Arg_Hydrox
Other DBs
NCBI-GeneID: 364948
NCBI-ProteinID: NP_001009716
RGD: 1306020
Ensembl: ENSRNOG00000061004
UniProt: Q5HZW3
Position
12q16
AA seq 343 aa
MWLEWLVAWSWSLDGLRDCIATGIQSVRDCDGTAVITVACLLVLFVWYCYHVGREQPRPH
VSVNSLLQGVDANGLQNGSMYCQSPECVRCTHHDGLNQKLYHNLQEYAKRYSWSGMGRIH
KGIREQGRYLSSQPSIQKPEVFFLPDLPTTPYFPRDAQKHDVELLERNFQAILCEFEALY
KAFSNCSLPQGWKVNSTPSGEWFTFDFVSQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVF
GNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSF
LHTSFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgtggctggagtggctggtagcctggagctggtctctggacggcctgagggactgcatc
gccactggtatccagtccgtgcgggactgtgacggcacagctgtcatcactgtggcctgc
ctgctcgtcttgtttgtgtggtactgttaccatgtgggccgagaacagccccgaccccac
gtatccgtcaactccctcctgcagggtgtggatgccaacgggttacagaacggatccatg
tactgccagtcccctgagtgtgtgcgctgcacgcaccacgacggcctcaaccagaagctc
taccacaacctgcaggagtacgccaagcgctactcatggtctggcatgggccgtatccac
aagggcatacgggagcagggccgctacctcagcagccagccctctatccagaagccggag
gtcttcttcctgcctgacctccccactacgccctacttccccagggacgcccagaagcac
gatgtggagctgctggagcggaacttccaggccatcctctgcgagttcgaggcactctac
aaagccttctctaactgcagcctccctcaggggtggaaagtgaacagcacccccagcggg
gagtggttcacctttgactttgtcagccagggcgtttgtgtccccaggaactgcaggaag
tgccctcggacttaccgcttactcggcagcctccggacctgtattgggaacaatgttttc
gggaacgcctgcatctcagtgctgagtcctgggaccgtgatcacggagcactatgggccc
acaaacatccgaatccggtgccacctaggtctgaagactcccaatggctgcgagctggtg
gtggggggtgagccccagtgctgggcagaaggccgatgcctactcttcgacgactccttc
ctgcacacctcgttccatgaaggttctgctgaggatggcccacgggtggtcttcatggtg
gacctctggcaccccaacgtggcagctgctgaacgtcaggccctggatttcatctttgct
ccaggacgatga

DBGET integrated database retrieval system