KEGG   Rattus norvegicus (rat): 364974Help
Entry
364974            CDS       T01003                                 

Gene name
Rnaseh2a
Definition
(RefSeq) ribonuclease H2, subunit A
  KO
K10743  ribonuclease H2 subunit A [EC:3.1.26.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    364974 (Rnaseh2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    364974 (Rnaseh2a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     364974 (Rnaseh2a)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    364974 (Rnaseh2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_HII ALG11_N XFP
Motif
Other DBs
NCBI-GeneID: 364974
NCBI-ProteinID: NP_001013252
RGD: 1307248
Ensembl: ENSRNOG00000003504
UniProt: Q5U209
Position
19q11
AA seq 301 aa AA seqDB search
MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADL
EALKVADSKTLTENERERLFAKMEEDGDFVGWALDILSPNLISTSMLGRVKYNLNSMSHD
TAAGLIQHAMDQNVKVTQVFVDTVGMPETYQARLQQRFPGIEVTVKAKADSLFPVVSAAS
IIAKVARDQAVKNWQFVESLQGLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWS
TAQAILEKEAESVTWEDSAAEEDPEGPGRITSYFSQGPQACRPQVSHKYFQERGLETATS
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagcgaactggagagggacaatacaggccgttgtcgcctgagttctcctgta
cctgccgtgtgcctcaaggagccgtgcgtcctgggcgtggatgaagcgggccggggtcct
gtgcttggtcccatggtctacgccatctgttactgccccctgtcccgcctggcagatctg
gaggccctgaaagtagcagactcaaagaccttgacagagaatgagcgggagaggctcttt
gcgaaaatggaagaggacggagactttgtgggttgggctttggacatcctgtctccaaac
ctgatctctaccagcatgcttgggcgggtcaaatacaacctcaactctatgtctcacgac
acagccgcggggctgatacagcatgcgatggatcagaatgtgaaagtcacccaggtgttt
gtggacactgtaggaatgccagagacataccaggctcgactacagcagcggtttccaggg
atcgaggtgacagtcaaggccaaagctgactccctgttccctgtggtcagtgctgccagc
atcattgccaaggtggcccgagaccaggctgtgaagaactggcagtttgtggagagttta
cagggtctggactcagattatggctcaggctatcccaatgatcccaagaccaaagcctgg
ctgaggaaacatgtggaccctgtgtttggcttcccccagtttgtacggttcagttggagc
acagcccaggccatcctggaaaaggaggcagaaagtgtcacctgggaagactcagcagct
gaggaggatcctgagggacccggaagaatcacctcctacttcagccagggcccgcaggcc
tgccgccctcaggtctcccacaaatacttccaggagcgaggcctggagacagccaccagc
ctctag

DBGET integrated database retrieval system