KEGG   Rattus norvegicus (rat): 364993
Entry
364993            CDS       T01003                                 

Gene name
Pskh1
Definition
(RefSeq) protein serine kinase H1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: THEG4
Other DBs
NCBI-GeneID: 364993
NCBI-ProteinID: NP_001102367
RGD: 1304648
Ensembl: ENSRNOG00000019290
UniProt: D4ABY1
Position
19q12
AA seq 44 aa
MGCGTSKKSSPTFVLSFGVLPFAASLLELPDPPLQLHCATYCLV
NT seq 135 nt   +upstreamnt  +downstreamnt
atgggctgtgggacaagcaagaagtcatcaccaacctttgttctgtcctttggtgtgttg
ccctttgctgcttcccttctggagctgccagaccctcctttacagctccactgtgccacc
tactgtctggtctag

DBGET integrated database retrieval system