KEGG   Rattus norvegicus (rat): 365023Help
Entry
365023            CDS       T01003                                 

Gene name
Ankrd11
Definition
(RefSeq) ankyrin repeat domain 11
  KO
K21436  ankyrin repeat domain-containing protein 11/12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    365023 (Ankrd11)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     365023 (Ankrd11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4 DUF3348
Motif
Other DBs
NCBI-GeneID: 365023
NCBI-ProteinID: XP_003753164
RGD: 1306679
Ensembl: ENSRNOG00000027906
UniProt: D3ZSU6
Position
19q12
AA seq 2605 aa AA seqDB search
MESRKTRTQMPPAQSMLWYCKAGTVLEAPWHEMEVPRSKKKEKQGPERKRIKKEPVPRKS
GLLFGMGLSGIRAGYPLSERQQVALLMQMTAEESANSPVDTTPKHPSQSTVCQKGTPNSA
SKTKDKVNKRNERGETRLHRAAIRGDARRIKELISEGADVNVKDFAGWTALHEACNRGYY
DIAKQLLAAGAEVNTKGLDDDTPLHDAANNGHYKVVKLLLRYGGNPQQSNRKGETPLKVA
NSPTMVNLLLGKGTYTSSEESSTESSEEEDAPSFAPSSSVDGNNTDSEFEKGLKLKAKNP
EPQKTVTPVKDEYEFDEDDEQDRVPPVDDKHLLKKDYRREAKSNSFISIPKMEVRSYSKN
NTLAPKKAAHRILSDTSDEEDVSASIGAGEKLRLSAHTMLPSSKARESSSSRQQKEKNKL
KKKRKKETKGKEVRFGKRSDKFCSSGSESESSESEEDDGDSVGSSGCLKGSPLVLKDPSL
FSSLSASSTSSHGSAVAQKHSSGHTDQHTKHWRTDNWKAISSPAWSEVSSLSDSSRTGLT
SESDCSSEGSSVESLKPTRRKQEHRKRGSLQSMPERRGTFHPCADGAVPKLDKEGKVVKK
HKTKHKHKHKEKGPCSVSQELKLKSFTYEYEDSKQKPDKAILLENDVSTENKLKVLKHDR
DKLSKTKSEDKEWLFKDEKALKRMKDVSKDTSRAFREERDRPSKTERERSTKEKSPKEEK
LRLYKEERKKKSKDRPFKLEKKNDMKEVSKEKEKAFREDKEKLKKEKLCRDDAAFDDYCN
KSQFLDHEDTKFSLSDDQQERWFSDLSDSSFDFKGEDSWDSVTDYRDIKSDSVAKLILET
VKEDSKEKKRDNKTREKRDFRDSFFRKRDRDCVDRNSEKRRDHTEKQRSFPSYLSEKDKK
RRESAEGGRDRRDTLEGSRERRDGRIRSEEVHREDLKECGCDSTFKDKSDCDFTKTLEPW
ERPHAAREKEKKDALEKDRKEKGRAEKYKDKSGERERNEKSILEKCQKDKEFEKCFKEKK
DGKEKHKDTHSKDRKTPFDQLREKKEKAFSSLISEDFSERKDDRKGKEKSWYIADIFTDE
SEDEKEECVASSFKTGETGDSQRAESLQEKEDGREHPSDRHRKASSDRQHTEKPRDKEPK
EKRKDRGAAEGGKDKKEKIFEKHKEKKDKECAEKYKERKDRASVDSAPEKKNKQKLPEKV
EKKHFVEDKAKSKHKEKPEKDHSRERKSSRGPDVEKSLLEKLEEEALHDYREDSNDKISE
VSSDSFADHGQEPSLSTLLEVSFSEPPAEDKARESTCLSEKLKERERERHRHSSSSSKKS
HERERAKKEKADKKEKGEDYKDGGGGRKDASQYEKDFADAEAFGGSYTTKADTEEDLDKA
IELFSSEKKDRNDSEREPAKKLEKELKPYGSSTISILKEKKKREKHREKWREEKEKHRDK
HIDGFLRHHKDEPKPAAKDKDNPPNCFKEKSREESLKLSEAKLKEKFKENAEREKGDSVK
MSNGNDKPLPSRDANKKDSRPREKLLGDGDLMMTSFERMLSQKDLEIEERHKRHKERMKQ
MEKMRHRSGDPKLKEKKPTDDGRKKSLDFPSKKALGLDKKVKEPAPVLPTGEGKPHSGPG
TESKDWLAGQPLKEVLPASPRTEQGRPTGVPTPTSVVSCPSYEEVMHTPRTPSCSADDYP
DLVFDCTDSQHSMPVSTTSTSACSPPFFDRFSVASSVVAENAGQTPTRPISTNLYRSISV
DIRRTPEEEFSVGDKLFRQQSVPAASSFDSPVQHLLEEKAPLPPVPAEKFACLSPEYYSP
DYGIPSPKVDTLHCPPTAVVSATPPPDSVFSNLPPKSSPSPRGELLTPAIEGALPPDLGL
PLDATEDQQATAAILPPEPSYLEPLDEGPFNTVITEEPVEWTHSAAEQSLPSSLIASASE
TPVSWPVGSELMLKSPQRFAESPKHFCPGEPLHSTTPGPFSAAEPTYPVSPGSYPLPAPE
PALEEVKDGGTGAIPVAIAAAEGAAPYTAPTRLESFFSNCKPHPDAPLDTAPEPASVTTV
AQVEALGPLESSFLDSSHSISALSQVEPVSWHEAFTSPEDDLDLGPFSLPELPLQAKDAS
DVEAETAEASPAPPVESPPGPTGVLSGGDVPASTTEEPPAPPPQEASPQLSTEPEPSEET
KLDVVLEAAAETEVLADDSAPEASISNLVPAPSPPEQQRPAGGGDEETEAEDPSAAPCCA
PDGPTTDGLAQAPNSAEAACVVAAVEGPPGNIQPEATDPEPKPTSEAPKAPKVEEVPQRM
TRNRAQMLASQSKQGIPATEKDSMPAPASRAKGRAPEEEDAQAQHPRKRRFQRSGQQLQQ
QLNTSTQQTREVIQQTLAAIVDAIKLDAIEPYHSDRSNPYFEYLQIRKKIEEKRKILCCI
TPQAPQCYAEYVTYTGSYLLDGKPLSKLHIPVIAPPPSLAEPLKELFKQQEAVRGKLRLQ
HSIEREKLIVSCEQEILRVHCRAARTIANQAVPFSACTMLLDSEVYNMPLESQGDENKSV
RDRFNARQFISWLQDVDDKYDRMKTCLLMRQQHEAAALNAVQRMEWQLKAQELDPAGHKS
LCVNEVPSFYVPMVDVNDDFVLLPA
NT seq 7818 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagaaagactcggacacagatgcctccagctcagtccatgttgtggtactgc
aaggctggtacggtcctcgaagcaccatggcatgaaatggaggttcctagaagcaagaag
aaagagaagcagggtcctgaacggaagaggatcaagaaggaacctgttccccgaaagtcc
gggctattgttcggcatggggctgtctgggatccgagctggatacccgctctctgagcgt
cagcaggtggctctgctcatgcagatgaccgccgaggagtctgcaaatagtccagtagac
accacaccaaagcacccttcccagtctacagtgtgtcagaaggggacccccaactccgcc
tcaaaaaccaaagataaggtgaataagagaaatgagcgaggagagacgcgcctgcaccga
gcagctattcgaggtgatgcccggcgcatcaaggagctcatcagtgagggcgcagacgtt
aatgtcaaggactttgcaggctggactgcactgcacgaggcatgtaaccggggctactat
gacatcgccaagcagctgttagccgctggtgcggaggtgaacactaagggcctggacgat
gacacgcctttgcacgacgccgccaacaacgggcactacaaggtggtgaagttgttgtta
cgatatggcggaaatcctcagcaaagcaacagaaaaggcgagacaccgttgaaagtagcc
aattccccaacgatggtgaatctcctgttaggcaaaggcacatacacttccagtgaggaa
agctctactgagagctctgaagaagaggatgccccatcctttgcaccttccagctccgtc
gatggcaataacacagactctgagtttgagaaaggcctcaagcttaaggctaagaaccca
gagccccagaaaactgtgacccctgtcaaggacgagtacgagtttgacgaggatgacgag
caagacagggtccccccggtggatgacaagcacttgctgaagaaagactataggagggaa
gccaagtccaacagcttcatctccatacccaaaatggaagtgaggagttactccaaaaac
aacacgctcgcaccaaagaaggcggcccatcgcatcttgtcagacacatcagacgaggag
gatgtgagtgcctccataggggctggagagaaactgaggctgtcagcacacacaatgcta
cctagtagtaaggcacgagagtcttctagttctaggcagcaaaaagaaaaaaataaattg
aaaaagaagcgaaagaaagaaacaaaagggaaggaagttcggtttggaaagaggagtgac
aagttctgttcctctgggtcagaaagcgagtcctcagagagtgaggaggatgacggggac
tctgttgggagctcaggctgcctcaaggggtccccactggtgctgaaggacccttccctg
ttcagctcactgtctgcctcctccacctcgtctcatggtagtgctgtggcccagaaacac
agctctggccacactgaccagcacactaagcactggcgcactgacaattggaaagccatt
tcttctccagcctggtctgaggtgagttctttgtcagactcctcaaggacgggactgacc
agtgagtctgactgctcctccgagggctccagtgtggaatctctgaagcctacaaggagg
aagcaggagcaccgtaaaaggggcagcctgcagagcatgccggagaggagaggcaccttc
cacccctgtgcagacggggctgtccccaagctggacaaggaagggaaggtggtcaaaaaa
cacaagacgaaacacaaacacaaacacaaggagaaaggaccatgttctgtcagccaagaa
cttaaactgaaaagctttacatatgaatatgaggactccaagcaaaagcccgataaggcc
atcctcctcgagaacgacgtctccactgaaaataagttgaaagtgctgaaacacgacaga
gacaaactcagtaagacgaagtcggaggataaagagtggctctttaaggatgagaaagcc
ctcaagagaatgaaggacgtcagcaaagacaccagcagagctttccgagaggaaagagac
cgtcccagtaaaacagagagggagagatccacaaaggagaagtctcctaaggaagagaaa
ttaagactgtacaaagaagaaaggaagaaaaagtccaaagatcgaccgttcaagctagaa
aagaagaacgacatgaaggaggtctccaaggagaaggagaaggccttcagagaggacaaa
gagaagctcaagaaggaaaagctgtgcagggacgacgctgcttttgacgactactgtaac
aaaagccagtttctggaccacgaggacaccaagttcagcctctctgatgaccagcaagag
aggtggttttctgacctgtcagactcctcttttgatttcaaaggagaggatagctgggac
tcagtgacagactacagagacatcaagagtgactcagtggccaaacttatcctggaaacc
gtcaaagaagacagtaaggaaaagaagcgtgacaacaagacccgggagaagcgagatttc
agagactctttcttccggaagagagacagggactgtgtagacaggaattctgagaagagg
agagaccacacagaaaagcagagaagcttccccagctacctctctgagaaggacaagaaa
aggcgggagtctgcagaagggggccgggacaggagggacaccctagagggctcccgggag
cggagggatgggcggattcggtctgaagaggtgcatagggaggacctaaaggagtgtggc
tgtgatagcaccttcaaggacaagtcagactgtgacttcaccaagaccctggagccctgg
gaacggccccatgcagcacgggaaaaagagaaaaaggatgccctagaaaaggacaggaag
gaaaagggcagggcagagaaatacaaagataagtccggtgagagggagagaaacgagaag
tctatcctcgagaagtgtcagaaagacaaagaatttgaaaaatgctttaaagagaagaaa
gacggcaaggaaaagcataaagacacacacagcaaagacaggaaaaccccctttgaccaa
ctgagagaaaagaaagagaaggcgttctccagcctcatctcagaagacttctcagagaga
aaggacgacaggaagggaaaggagaagagctggtacatcgcagacatattcaccgatgag
agcgaggatgagaaagaggagtgcgtggccagcagcttcaagactggagagaccggtgac
agccagcgagcggagagcctgcaggagaaggaagatggaagagaacacccctcagatagg
cacaggaaggcctcctccgacaggcagcacacagaaaaaccaagggacaaagagcccaag
gaaaagaggaaggacagaggagctgcggaagggggaaaggacaagaaggaaaagatcttc
gagaagcacaaagaaaagaaagataaagagtgtgcagagaaatacaaggaaaggaaagac
agagcctctgttgactctgccccagaaaagaagaataaacagaaactccctgagaaggta
gaaaagaagcactttgttgaagacaaggcaaagagtaaacacaaggagaagccagagaag
gaccattcccgggagagaaagtcttcccgaggccctgatgtggagaagagcctgctggag
aagctggaggaagaggccttgcatgactaccgggaggactccaatgacaagatcagtgag
gtctcctctgacagttttgctgaccatggccaggaacccagcctgagcacgctcctggaa
gtgtccttctctgagcccccagcagaggacaaggccagggagagcacttgcctctcagag
aaactgaaggagagggagagggagaggcacaggcattcctcgtcttcctctaagaaaagc
cacgagcgtgagagagctaagaaggagaaggctgacaagaaagagaagggcgaagactac
aaggacggcggcggcggcaggaaggacgccagccagtacgagaaggacttcgcggatgca
gaggcttttgggggttcctacacaacaaaagcagacacggaagaggacctagataaggct
atagaactgttctcctcagagaagaaagacagaaacgattctgagagagaacctgccaag
aaactagagaaggagttaaagccgtatgggtcaagtaccatcagcatcctgaaagaaaag
aagaagagagagaaacatagggagaaatggagggaagaaaaggagaaacacagggacaag
catatagacgggttcctgagacatcacaaggatgagccaaagcctgcagccaaagacaag
gacaaccctcccaactgctttaaggagaagtccagagaggaaagcctgaagctcagtgag
gccaagctgaaggagaagttcaaggagaacgcagaacgagaaaagggcgactccgtgaag
atgagcaacggcaacgacaagcctctgccatcccgagacgcaaacaagaaggacagcagg
ccccgcgagaagctcctgggagatggcgacctcatgatgaccagctttgagaggatgctg
tcccagaaagaccttgagatcgaggagcggcacaagcggcacaaggagcgcatgaagcag
atggagaagatgcggcacaggtctggagaccccaagctcaaagagaagaagcccacggat
gatgggcgcaagaagagcctagacttcccttccaagaaagctctggggctggacaagaag
gtcaaggagccggctcccgtgctgcccactggtgaaggcaagccacattctggaccaggc
acagagtccaaagactggttggctggacaacccttgaaggaggttctgcctgcttcaccc
cgcactgagcagggccgacccactggggtgcccacgcccacctcagtagtgtcatgcccc
agctatgaagaggtgatgcacacacccagaaccccatcatgcagtgctgatgattaccct
gacctggtcttcgactgcactgactcccagcactcgatgcccgtctccaccacttccacc
agcgcctgctctccacccttttttgacaggttctctgtggcttccagtgtggttgcagaa
aatgcaggccagactcccacaaggcctatctccacaaacctttatcgctcgatatctgtg
gatatcagaaggacacccgaagaggaattcagtgttggggacaagctgttcaggcagcag
agtgtccctgcagcctcaagttttgattccccagtacagcacttgctggaagaaaaggct
cctctgccccccgttcctgcagaaaagtttgcctgcctgtcccccgagtactactcccca
gactacggcatcccctcgcccaaggtagacaccctgcactgtccaccgaccgctgtggtc
agtgccacaccgcccccagacagcgtcttctccaacctaccaccaaagtcttccccttcc
cctagaggtgaactgttgaccccagccattgaaggggccctgcccccagatctgggccta
cctctggatgccacagaggaccagcaagccacagctgccatccttcccccagagcccagc
tatctggagcccctggatgagggccccttcaacacggtcatcaccgaggagcccgtcgag
tggacgcacagtgctgctgagcagtcccttccctcctcccttattgctagtgcctctgaa
acccctgtcagctggcctgtgggctctgagcttatgctaaagtctccacagaggtttgca
gaatccccaaaacatttctgccctggagaacccctccattccaccaccccaggacccttc
agtgctgcagagcccacataccccgtctctccgggatcttaccccttgccagcccctgag
ccagccctggaagaagtcaaagacggtgggacaggagcaatcccagtggccatcgctgct
gcagaaggggctgctccttacactgcccccactaggctggagtcatttttcagcaactgc
aagccacacccagatgcacccctggacacagcccctgaacctgcaagtgttactactgtg
gctcaggtagaggctctgggacccctggagagcagcttcctagacagcagtcatagcata
tctgccctcagccaggtggaaccagtatcatggcatgaggcctttaccagccctgaggac
gacctcgacctggggcccttctcactgccagagcttcctctccaggccaaagatgcttca
gatgttgaggcagaaactgcagaggccagtcctgcccctccagtagagagccctccaggc
cccacgggggttctcagtggaggggatgtccctgcctccacaactgaggaaccaccagcc
ccacctcctcaggaagcatcccctcagctctccacagagcccgagccctcagaggagaca
aagctggatgtggttctagaagctgcagcggaaacagaagtcctggcagatgacagtgcc
cccgaagcctcaatctccaatttggtgccagcacccagtccccctgaacagcagcgcccc
gcaggaggtggtgatgaagagactgaagctgaagatccttctgctgctccctgctgtgcc
cctgatggacccaccacagatggcttggcacaggcacccaacagtgcagaggccgcctgt
gttgtggctgctgttgaagggcccccaggcaacattcagccagaagctacagacccagag
cccaaacctacatccgaagcccccaaggcccccaaggtggaagaagttcctcagcggatg
accaggaaccgtgcccagatgctggccagccagagcaagcagggcatacccgcaacagag
aaggactcaatgcctgccccagcctctagagccaagggccgtgcccctgaggaggaggac
gcccaggcccagcacccccgcaagcggcgcttccaacggtctggtcagcagctgcagcag
cagctgaacacatccacacagcagacccgcgaggttattcagcagacgctggcagccatc
gtggatgcaattaaactggacgccattgagccctaccacagcgacaggtccaacccatac
tttgagtaccttcagatcagaaagaagatcgaagagaaacggaagatcctctgctgcatc
actccgcaggccccccagtgctatgctgagtatgtcacctacacggggtcctacctcctg
gacggcaagcccctcagcaagctgcacatccctgtgattgcaccccctccctctctagca
gagcctctgaaggagctgttcaagcaacaagaggctgtgcggggtaagctgcgtctgcag
cacagcatcgagagggagaagctgattgtgtcctgtgagcaagagattcttcgggttcat
tgccgggcagccaggaccattgccaatcaggcagtgccattcagtgcatgcacaatgctg
ctggactccgaggtctacaacatgcctctggagagccagggggatgaaaacaagtctgta
cgagaccgcttcaatgctcgccagttcatctcctggctgcaggacgtagacgacaagtat
gaccgcatgaagacatgtttgctgatgcggcagcaacatgaagctgcagccctcaatgcc
gtgcagaggatggagtggcagttgaaggcccaggagctggaccctgctgggcacaagtcc
ctgtgtgtaaatgaggtgccatccttctacgtgcccatggttgacgtcaacgatgacttt
gtactgttgccagcatga

DBGET integrated database retrieval system