KEGG   Rattus norvegicus (rat): 365057
Entry
365057            CDS       T01003                                 

Gene name
Map3k5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04071  Sphingolipid signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04530  Tight junction
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    365057 (Map3k5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    365057 (Map3k5)
   04668 TNF signaling pathway
    365057 (Map3k5)
   04071 Sphingolipid signaling pathway
    365057 (Map3k5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    365057 (Map3k5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    365057 (Map3k5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    365057 (Map3k5)
  09159 Environmental adaptation
   04714 Thermogenesis
    365057 (Map3k5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    365057 (Map3k5)
   05012 Parkinson disease
    365057 (Map3k5)
   05014 Amyotrophic lateral sclerosis
    365057 (Map3k5)
   05016 Huntington disease
    365057 (Map3k5)
   05017 Spinocerebellar ataxia
    365057 (Map3k5)
   05022 Pathways of neurodegeneration - multiple diseases
    365057 (Map3k5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    365057 (Map3k5)
   05418 Fluid shear stress and atherosclerosis
    365057 (Map3k5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    365057 (Map3k5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    365057 (Map3k5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    365057 (Map3k5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     365057 (Map3k5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   365057 (Map3k5)
SSDB
Motif
Pfam: MAP3K_TRAF_bd Pkinase PK_Tyr_Ser-Thr ASK_PH FPP Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 365057
NCBI-ProteinID: NP_001264623
RGD: 1306565
Ensembl: ENSRNOG00000031700
Position
1
AA seq 1381 aa
MGTEAGEGITFSVPPILSAGFCPIPEGGSCRRGGGAATAAEGEPSLQPLLMPPPPPPPGS
FWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTVAYVINEASQGQLVVAESEAL
QSLREACEAVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRE
SFSMANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVYCCDSSFMKG
LTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSSQYFRESILNDIRKARNLYTGKELA
AELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKF
HYAFALNRRNLPGDRAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDSNFTDTESRD
HGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQ
SYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQPT
AKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLP
DDKKGIHEWNFNASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTI
TEEKGRGAEEGDCEGDSLEYDYEHDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPE
RDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPL
KDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGIN
PCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFK
VGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSG
MWLHGEEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKTRAKSCGEKDGKGI
RTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESL
AQGPEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSRLKLELDFDSHGISQVQVVLFG
FQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLD
VDDEHEESPSNQTARRPQPVAEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMKMETN
RLLEELVRKEKELQALLHQAIEEKDQEIKHLRLKSQPIDTPGFPVCHLNAPGTAIEDSEL
TGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKG
A
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgggcaccgaagccggcgagggcatcactttctccgtgccgcccattttgtccgcgggt
ttctgccccatcccggagggcggcagctgccggaggggaggaggagcggcgacggcggcg
gagggcgagccgagcctgcagcccttgcttatgccgccgccgccaccaccgccgggcagt
ttctggaacgtggagagcgcggcggctcctggcaccagctgccctaccaccgcccccggg
agcagcgccacccgaggccggggcaactctggcagcgggggcggccggcgtaccaccgtg
gcgtatgtgatcaacgaggcgagccaggggcagctggtggtggcggagagcgaggccctg
cagagcctgcgggaggcgtgcgaggcggtgggcgccaccctggagaccctgcatttcggg
aagctggactttggggaaaccaccgtgctggaccgtttttacaacgctgacatcgccgtg
gtagagatgagtgacgccttccggcagccttccctgttttatcatctcggagtgagagag
agcttcagcatggccaacaacatcatcctctactgcgatactaattcagactcgcttcag
tccctgaaggaaatcatttgccagaagaacacagtgtgcactgggaactacaccttcatc
ccctacatggtgacaccacacaacaaggtctactgctgtgacagcagcttcatgaagggc
ctgaccgagctcatgcagcccaacttcgagctcctgctggggccgatctgcttacctctc
gtggaccgtttcgttcagctcctgaaggtggcgcaagccagttccagccagtacttccgg
gaatctatactcaacgacatcaggaaagctcggaatctgtacactggtaaagagttggcg
gctgagctggcgaggatccggcagcgggtagacaatattgaagttctgacggcagacatt
gttatcaacctgttgctttcctacagagatatccaggactatgactccatagtgaagctg
gtagagaccttagaaaaactaccgaccttcgatctggcctcgcaccaccacgtgaagttt
cattatgcctttgcactgaacaggagaaatctccctggagacagagcaaaagctcttgac
atcatgatccccatggtgcaaagtgaagagcaagttgcttcggatatgtactgtctcgtt
ggccgaatctacaaagacatgtttttggattcaaatttcactgacaccgaaagcagggac
catggagcatcttggttcaaaaaggcgtttgagtctgagccaacactacagtcaggaatt
aattacgcagtcctcttgctggcggctgggcaccagtttgaatcttcttttgagcttcgg
aaagttggagttaaactgagcagccttctgggtaaaaaggggaacttggagaaactccag
agctactgggaagtcggattttttctgggagccagcgtcctggccaacgaccatctgagg
gtcattcaggcatctgagaaactgttcagactgaagacgccagcgtggtacctcaagtct
attgtggagaccattttgatatataagcattttgtgaaactgaccacagagcagcccaca
gccaagcaggagctcgtggacttctggatggatttcctggtggaggccacaaagacagat
gttactgtcgttagatttccagtgttaatattagagccaacgaaaatctatcagccttct
tacctgtcgatcaacaatgaagtcgaggagaagacgatctctatttggcatgtcctccct
gacgacaagaagggtatccatgagtggaactttaacgcttcctctgtcaggggggtgagt
atctccaagtttgaagaacgatgctgtttcctttatgtacttcacaattccgacgacttc
caaatctacttctgcacagaactgcactgtaaaaggtttttcgaaatggtgaacaccatc
accgaagagaaggggagaggcgcggaggaaggagactgtgaaggtgactccctagagtat
gactacgaacacgatgaaaatggagacagagttgtgctaggaaaggggacttacgggata
gtctacgcaggccgagacctgagcaaccaggtcagaattgctattaaggaaatcccagag
agagacagcagatactctcagcccctgcatgaggaaattgccttacacaagcatctgaag
cacaagaacattgtccagtatctgggctccttcagtgagaacggcttcatcaaaatcttc
atggagcaagtcccaggaggaagtctctctgctctcctccgttcaaaatggggcccacta
aaagacaatgagcagacgattggcttctatacgaagcaaatattggaaggattaaaatat
cttcatgacaatcagatagtccaccgggatataaagggtgacaatgtattgattaatacc
tacagtggcgtgctcaagatctctgactttgggacatccaagaggcttgctggcataaac
ccgtgcaccgaaacctttacaggtacccttcagtatatggcgccagaaatcatcgataaa
ggaccacgaggctatggaaaggccgccgacatttggtcactgggctgtacgatcatcgaa
atggctactggaaaaccaccgttttatgaactaggagagccccaggcagccatgttcaag
gtggggatgtttaaggtccaccccgagatcccagagtccatgtctgccgaggccaaggcg
ttcatactgaagtgttttgaaccagaccctgacaagagagcctgtgctaatgacctgctt
gttgatgagttcctaaaagtttccagcaaaaagaagaagacacagcccaaactctcgggt
atgtggttgcacggagaggagtatcttagaagcatctcgctgccggtccctgtcctggta
gaagacaccagcagcagcagcgagtatggctccgtttctccggacacagagctgaaggcc
gaccccttctccttcaaaaccagagctaagtcctgtggagaaaaggacgggaaagggatc
cggacgctgttcctgggcattccggatgaaaactttgaagatcacagtgcgcccccgtcc
cctgaagagaaagactccggcttttttatgctgagaaaggatagcgaaaggcgggcgacc
cttcacaggatcctgacagaagaccaggacaaggttgtgaggaacctaatggagtctctg
gcccagggtcctgaagagcctaaactcaagtgggaacacatcacaactctcatctcaagc
ctcagagagtttgtgaggtccactgaccggaaaatcatagccactacactgtccaggctc
aagctggagctggacttcgacagccatggcatcagccaggtgcaggtggtcctctttggc
ttccaggatgcggtcaataaagttctccggaatcataacatcaagccacactggatgttt
gccttggacagtatcattcggaaggctgtgcagacagctatcaccatcctggttccagag
ttgaggccacatttcagcctcgcgtcggagagcgacacggcggatccggaagacttggat
gtcgacgatgaacacgaggaatcgccttcgaatcaaaccgcgcggaggccccaacccgtc
gcggaggatgccgtggctacctcaggggtgagcacgctcagctccaccgtatcccatgat
tcccagaatgcacaccgctcgctgaatgtgcagcttgggaggatgaagatggaaactaac
agattacttgaagagttggttcggaaagagaaagagttgcaggcactccttcatcaagcc
attgaagaaaaggaccaagaaattaagcacctgagacttaagtcccaacccatagatacc
cctgggtttcccgtgtgccacctgaacgctcctggtacagccattgaagactctgaactt
actggctggctgagggaaaatggagctgacgaagacactataagtcggtttctggctgag
gattacacgctggtggatgtcctttactacgtcacgcgtgacgacttgaagtgcctccga
ctaaggggagggatgctgtgcacgctgtggaaggccatcattgactttcggaacaaaggg
gcctga

DBGET integrated database retrieval system