KEGG   Rattus norvegicus (rat): 365155
Entry
365155            CDS       T01003                                 

Gene name
Prdm9, Prdm7
Definition
(RefSeq) PR/SET domain 9
  KO
K20796  [histone H3]-lysine4 N-trimethyltransferase PRDM7/9 [EC:2.1.1.354]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    365155 (Prdm9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    365155 (Prdm9)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     365155 (Prdm9)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     365155 (Prdm9)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_11 SSXRD zf-C2H2_6 zf-H2C2_5 zinc_ribbon_15 KRAB Zn-ribbon_8 SET zf-C2H2_3rep Zn_ribbon_SprT zf_PR_Knuckle
Other DBs
NCBI-GeneID: 365155
NCBI-ProteinID: NP_001102373
RGD: 1305247
Ensembl: ENSRNOG00000021493
UniProt: P0C6Y7
Position
1q12
AA seq 796 aa
MSRTMNTNKPEENSTEGDAGKLEWKPKVKDEFKDISIYFSKEEWAEMGEWEKIRYRNVKR
NYKMLISIGLRAPRPAFMCYQRQAIKPQINDNEDSDEEWTPKQQVSSPWVPFRVKHSKQQ
KETPRMPLSDKSSVKEVFGIENLLNTSGSEHAQKPVCSPEEGNTSGQHFGKKLKLRRKNV
EVNRYRLRERKDLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPVFVKDSVVDRGHPN
HSVLSLPPGLRIGPSGIPEAGLGVWNEASDLPVGLHFGPYKGQITEDEEAANSGYSWLIT
KGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGRELLVW
YGDEYGQELGIKWGSKMKKGFTAGRELRTEIHPCFLCSLAFSSQKFLTQHVEWNHRTEIF
PGASARINPKPGDPCPDQLQEHFDSQNKNDKASNEVKRKSKPRHKWTRQRISTAFSSTLK
EQMRSEESKRTVEEELRTGQTTNIEDTAKSFIASETSRIERQCGQCFSDKSNVSEHQRTH
TGEKPYICRECGRGFSQKSDLIKHQRTHTEEKPYICRECGRGFTQKSDLIKHQRTHTEEK
PYICRECGRGFTQKSDLIKHQRTHTGEKPYICRECGRGFTQKSDLIKHQRTHTEEKPYIC
RECGRGFTQKSSLIRHQRTHTGEKPYICRECGLGFTQKSNLIRHLRTHTGEKPYICRECG
LGFTRKSNLIQHQRTHTGEKPYICRECGQGLTWKSSLIQHQRTHTGEKPYICRECGRGFT
WKSSLIQHQRTHTVEK
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgtcccgcaccatgaacaccaacaagccggaagagaatagtactgaaggagatgcaggg
aaactcgagtggaaacccaaggtcaaagatgagttcaaagacatttccatatacttctcc
aaagaagaatgggcagagatgggagagtgggagaaaattcgctatagaaatgtgaaaagg
aactataaaatgctgatttctataggtctcagagcccctagaccagctttcatgtgttac
caaaggcaggcaatcaagccccagataaatgacaatgaggattctgatgaggaatggaca
ccaaagcagcaagtcagttctccttgggtgcctttccgggtgaagcacagtaaacaacag
aaggaaacacccagaatgccattaagtgataaatctagtgtgaaggaagtatttggaata
gaaaatttgctgaacacaagtggctcagagcatgcccagaaaccagtgtgctcccctgaa
gaagggaatacctccggacagcactttggaaaaaaactgaaactcaggagaaagaatgtt
gaagtgaataggtacaggctgcgagagagaaaggaccttgcatatgaagaggtcagcgag
ccccaggatgatgactacctctattgtgagaagtgccagaatttcttcatcgacagttgt
cccaaccatgggcctcctgtatttgtaaaagacagtgtggtggacagggggcatcccaac
cactcagtcctcagtctgccccctgggctgagaattggtccatcaggcatccctgaagct
ggacttggagtatggaatgaagcatctgatctaccagtgggtctgcactttggtccctat
aagggccagattacagaggatgaagaggcagccaacagtggatactcctggctgatcacc
aagggaagaaactgctatgagtatgtggatgggcaggatgagtcccaagccaactggatg
aggtatgtgaactgtgcccgggatgacgaagagcagaacctggtggcctttcaatatcac
aggaaaatcttctatcggacctgccgggtcatcaggccaggtcgcgagcttctggtctgg
tatggggatgagtatggccaagagctgggcatcaagtggggaagcaagatgaagaaagga
ttcacagcaggaagagaactaaggacagagattcatccttgttttttgtgctctttggcc
ttctcaagtcagaaattcctcactcaacatgtagaatggaatcatcgcacagaaatcttc
ccaggagcatctgcaaggataaatcctaagccaggagatccctgtccagatcagcttcag
gaacattttgattcacagaacaagaatgacaaagccagcaatgaagtcaaaagaaaatcc
aaacccaggcataaatggacaagacagaggatttcaacagccttttccagtactctcaaa
gaacaaatgagatctgaggaaagtaagagaactgtagaagaagagcttagaacaggccag
acaacaaatatagaggacacagccaaatcatttattgcatcagaaacctcaagaattgaa
aggcaatgtgggcaatgtttcagtgataagtcaaatgtcagtgagcaccagaggacacac
acaggggagaagccctacatttgcagggagtgtgggcggggcttttcacagaagtcagac
ctcatcaagcaccagaggacacacacagaggagaagccctacatttgcagggagtgtggg
cggggctttacacagaagtcagacctcatcaagcaccagaggacacacacagaggagaag
ccctacatttgcagggagtgtgggcggggctttacacagaagtcagacctcatcaagcac
cagaggacacacacaggggagaagccctacatttgcagggagtgtgggcggggctttaca
cagaagtcagacctcatcaagcaccagaggacacacacagaggagaagccctacatttgc
agggagtgtgggcggggctttacacagaagtcaagcctcatccggcaccagaggacacac
acaggggagaagccctacatttgcagggagtgtgggctgggctttacacagaagtcaaac
ctcatccggcacctgaggacacacacaggggagaagccctacatttgcagggagtgtggg
ctgggctttacacggaagtcaaacctcatccagcaccagaggacacacacaggggagaag
ccctacatttgcagggagtgtgggcagggccttacatggaagtcaagcctcatccagcac
cagaggacacacacaggggagaagccctacatttgcagggagtgtgggcggggctttaca
tggaagtcaagcctcatccagcaccagaggacacacacagtggagaagtaa

DBGET integrated database retrieval system