KEGG   Rattus norvegicus (rat): 365176
Entry
365176            CDS       T01003                                 

Gene name
Zfp787, RGD1310536, Znf787
Definition
(RefSeq) zinc finger protein 787
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf_UBZ Zn-ribbon_8 zf-LYAR zf_C2H2_ZHX zf-C2H2_11 zinc_ribbon_9 zf-Di19 zf-C2HC_2 GAGA zinc_ribbon_15 HypA zf-H2C2_5 zf-RING_7
Other DBs
NCBI-GeneID: 365176
NCBI-ProteinID: NP_001102374
RGD: 1310536
Ensembl: ENSRNOG00000015456
UniProt: D3ZDN6
Position
1q12
AA seq 381 aa
MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPNKLSPPQSAPPPGPPPRP
RPPAPYICTECGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEK
PYACSECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVC
PRCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKAPEEATAADGEIAIPVGDG
EGIIVVGPPGDGAAAAAALAGVGTRATGTRSRRAPAPKPYVCIECGKGFGHGAGLLAHQR
AQHGDGLGAVGSEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSCGQSFYRAGGE
DDGEDQSVAARCAECRGGEAR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggagcttcgggaagaagcttggtctccagggccactggattctgaggaccagcagatg
gccagtcatgagaacccagtggacatcctcatcatggatgacgacgacgtcccaagctgg
cccccgaacaagctttccccacctcagtctgcacctcctcctgggcccccaccccggccg
cggccacctgcaccctacatctgcactgagtgtggcaaaagcttcagccactggtcgaag
ctgacgcggcaccaacgcacgcacacgggcgagcggcctaacgcctgtaccgactgcggc
aagaccttctcgcagagctcgcacctggtgcagcaccggcgcatccacacaggcgagaag
ccgtacgcctgctctgaatgcggcaagcgctttagctggagctcaaacctcatgcagcac
cagcgcatccacacaggcgagaaaccttatacttgccccgactgcggccgcagcttcaca
cagagcaagagcctggccaagcaccggcgctcccacagtggtctaaagcccttcgtgtgc
ccgcgctgcggcagaggcttcagccagcctaagagcctggcacgccacctacggttgcac
ccagagctgtcagggccgggtgtggcggccaaggtgctggcagccagtgtgcgccgagcc
aaggcacccgaggaagccacagcagcggacggcgaaatcgccatcccagtaggcgacggc
gagggcatcatcgtggtgggcccaccaggggacggcgctgcagcggccgcggctctggcc
ggggtggggacgcgggcaacggggacacggtcgcgcagggcgccggcgcccaagccgtac
gtgtgcatagaatgcgggaagggctttgggcacggggctgggctgctggcccaccagcgc
gctcagcacggggatgggctgggggcagtgggtagtgaggagcctgcacacatctgcgtg
gagtgtggtgagggcttcgtgcagggtgccgcacttcggagacacaagaagattcatgca
gttggggcgccctcggtctgcagcagctgcggacagagtttctatcgggcgggcggagag
gacgatggggaggaccagtctgttgctgcgcggtgtgcggaatgtcggggtggggaggcc
cggtag

DBGET integrated database retrieval system