KEGG   Rattus norvegicus (rat): 365179Help
Entry
365179            CDS       T01003                                 

Gene name
Zfp524, RGD1565485, Znf524
Definition
(RefSeq) zinc finger protein 524
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_11 Zn_ribbon_SprT AT_hook
Motif
Other DBs
NCBI-GeneID: 365179
NCBI-ProteinID: NP_001102375
RGD: 1565485
Ensembl: ENSRNOG00000016565
UniProt: A0A0G2JUJ1
Position
1q12
AA seq 314 aa AA seqDB search
MDNPSSDPLPSTLSGEEEKPLALLPPVPRGRRGRPPGAATTSNRTLKSSLPRKRGRPPRS
VQETPLTAAVDSSGSSDLLLIDDQGVPYTVPEGSAADGPQGSGSKRAPHFCPVCLRAFPY
LSDLERHSISHSELKPHVCKDCGKTFKRSSHLRRHCNIHAGLRPFRCVLCPRRFREAGEL
AHHHRIHSGERPYQCPSCRVRFTEANTLRRHYKRKHPELVGMPVRLCPPNPRPQPLWDDD
EGVPVQEGVQEESPEGKEPAWPISSTSPLSGCTAGGSAGAGHGQEGQDTLVSGGIPAVEG
DQKQGPKPLDSDAI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccccagctcagacccgttgccttcaactttgtctggggaggaagaaaaacct
ctggccttacttcctcctgttccccggggccgccgaggccgacctccaggggcagccacc
acctccaatcggactctcaagtcctccctccctcgaaagcggggccgcccccccagatca
gtgcaggaaaccccgttgacagcagcagtggacagcagtggcagcagcgatcttctgttg
atcgatgatcagggtgttccttatacagttcccgaagggtcagcagcagatgggccccaa
ggctctggctccaagagggccccacacttctgtcctgtgtgcctgagagccttcccctac
ctctctgacctggagcgccacagcatctcgcactcagaattgaagccacatgtgtgcaaa
gattgcggcaagaccttcaaacggtccagccacttgcggcgccattgcaacatccatgct
ggcctccggccattccgatgtgtgctctgccctcgccgattccgagaggcaggggagctc
gcacatcaccaccgcatccactccggtgagcgaccataccaatgtccctcatgcagggtg
cgcttcaccgaggccaatactctccggcgccattacaaacgcaaacacccagagcttgtg
gggatgcctgtgcgcctgtgccccccaaacccaaggccccaaccactgtgggatgacgac
gagggcgtccctgttcaagaaggagtacaggaggagagtcctgaaggaaaggagcctgct
tggcccatatcctccacttctcccctgtctgggtgtacagcggggggttcagctggtgct
gggcatgggcaagaaggacaagacacccttgtttctggtggtattcctgccgtggaaggg
gatcaaaagcagggacctaaacctctggattctgatgccatctag

DBGET integrated database retrieval system